Read other articles:

Donna DouglasDouglas, 1967LahirDoris Ione Smith(1932-09-26)26 September 1932Pride, Louisiana, A.S.Meninggal1 Januari 2015(2015-01-01) (umur 82)Zachary, Louisiana, A.S.MakamBluff Creek Community CemeteryPekerjaanAktris, penyanyi, penulisTahun aktif1956–2008Suami/istri Roland John Bourgeois, Jr. (1949–1954) Robert M. Leeds (1971–1980) Anak1 Donna Douglas (nee Doris Ione Smith; 26 September 1932 – 1 Januari 2015) adalah seorang aktris dan penyanyi Amerika, yang diken…

Si ce bandeau n'est plus pertinent, retirez-le. Cliquez ici pour en savoir plus. Cet article ne cite pas suffisamment ses sources (juin 2017). Si vous disposez d'ouvrages ou d'articles de référence ou si vous connaissez des sites web de qualité traitant du thème abordé ici, merci de compléter l'article en donnant les références utiles à sa vérifiabilité et en les liant à la section « Notes et références » En pratique : Quelles sources sont attendues ? Comment …

Disambiguazione – Se stai cercando altri significati, vedi San José (disambigua). San Josecity(EN) City of San José San Jose – VedutaVeduta LocalizzazioneStato Stati Uniti Stato federato California ConteaSanta Clara AmministrazioneSindacoMatt Mahan (D) dal 1-1-2023 TerritorioCoordinate37°18′15″N 121°52′22″W / 37.304167°N 121.872778°W37.304167; -121.872778 (San Jose)Coordinate: 37°18′15″N 121°52′22″W / 37.304167°…

American professional basketball player (born 1992) For other people named Joe Jackson, see Joe Jackson (disambiguation). Joe JacksonPersonal informationBorn (1992-02-08) February 8, 1992 (age 32)Memphis, Tennessee, U.S.Listed height6 ft 1 in (1.85 m)Listed weight171 lb (78 kg)Career informationHigh schoolWhite Station (Memphis, Tennessee)CollegeMemphis (2010–2014)NBA draft2014: undraftedPlaying career2014–2017PositionPoint guardCareer history2014–2015Bakersfi…

Lauro GazzoloGazzolo pada sesi pengalihan suara pada 1951LahirIlario Gazzolo(1900-10-15)15 Oktober 1900Nervi, ItaliaMeninggal2 Oktober 1970(1970-10-02) (umur 69)Roma, ItaliaPekerjaanPemeran, pengisi suaraTahun aktif1938-1970AnakNando GazzoloVirginio Gazzolo Lauro Gazzolo (nama lahir Ilario Gazzolo; 15 Oktober 1900 – 2 Oktober 1970) adalah seorang pemeran dan pengisi suara Italia.[1] Ia tampil dalam sekitar 106 film antara 1939 dan 1966. Referensi ^ Lauro Gazzolo…

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Suku Koto – berita · surat kabar · buku · cendekiawan · JSTOR Suku Koto merupakan satu dari empat suku (marga) induk yang terdapat dalam dua klan induk dalam etnis Minangkabau. Koto berkerabat dengan Pilian…

Angkatan Bersenjata Kerajaan ThailandกองทัพไทยKong Thap ThaiLambang Angkatan Bersenjata ThailandBendera Angkatan Bersenjata ThailandDidirikan18 Januari 1852Angkatan Angkatan Darat Angkatan Laut Angkatan UdaraMarkas besarBangkok, ThailandKepemimpinanPanglima Tertinggi Raja VajiralongkornPerdana Menteri dan Menteri Pertahanan Jenderal Prayut Chan-o-chaKepala Angkatan Pertahanan Jenderal Chalermpol SrisawatKekuatan personelUsia penerimaan21–49Wajib militer21Penambahanu…

Historical Native American tribe from Florida and Georgia, US For other uses, see Apalachee (disambiguation). ApalacheeApalachee territory in the Florida PanhandleTotal populationextinct as a tribeRegions with significant populationsUnited States Florida, southwestern GeorgiaLanguagesApalacheeRelated ethnic groupsother Muskogean peoples The Apalachee were an Indigenous people of the Southeastern Woodlands, specifically an Indigenous people of Florida, who lived in the Florida Panhandle until the…

Sporting event delegationBahamas at the2008 Summer OlympicsFlag of the BahamasIOC codeBAHNOCBahamas Olympic CommitteeWebsitewww.bahamasolympiccommittee.orgin BeijingCompetitors25 in 4 sportsFlag bearer Debbie Ferguson-McKenzieMedalsRanked 64th Gold 0 Silver 1 Bronze 1 Total 2 Summer Olympics appearances (overview)1952195619601964196819721976198019841988199219962000200420082012201620202024 The Bahamas sent a delegation of athletes to compete in the 2008 Summer Olympics, which were held in Be…

Luca GuadagninoLuca Guadagnino di Festival Film Internasional Berlin tahun 2017LahirAgustus 1971 (umur 52)Palermo, ItaliaKebangsaanItaliaPekerjaanSutradara, produser, penulis naskahTahun aktif1997–sekarang Luca Guadagnino (lahir tanggal 10 Agustus 1971) merupakan seorang sutradara film Italia.[1] Ia dikenal sebagai sutradara film Melissa P. tahun 2005. Ia berkolaborasi dengan Tilda Swinton beberapa kali dalam film The Protagonists (1999), I Am Love (2010), A Bigger Splas…

Reptiles of the superfamily Chelonioidea Sea turtlesTemporal range: Early Cretaceous-Holocene,[1] 110–0 Ma PreꞒ Ꞓ O S D C P T J K Pg N A green sea turtle, a species of the sea turtle superfamily Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Reptilia Order: Testudines Suborder: Cryptodira Clade: Americhelydia Clade: Panchelonioidea Superfamily: ChelonioideaBauer, 1893[2] Families Dermochelyidae Cheloniidae †Ctenochelyidae Synony…

NBC affiliate in Abilene, Texas KRBC-TVAbilene, TexasUnited StatesChannelsDigital: 29 (UHF)Virtual: 9BrandingKRBCProgrammingAffiliations9.1: NBCfor others, see § SubchannelsOwnershipOwnerMission Broadcasting, Inc.OperatorNexstar Media Group via JSA/SSASister stationsKTAB-TVHistoryFirst air dateAugust 30, 1953 (70 years ago) (1953-08-30)Former channel number(s)Analog: 9 (VHF, 1953–2009)Former affiliationsAll secondary:CBS (1953–1956)DuMont (1953–1956)ABC (1953–1979)Cal…

Extinct species of dinosaur Coelosaurus antiquusTemporal range: Late Cretaceous, 70–66 Ma PreꞒ Ꞓ O S D C P T J K Pg N ↓ Holotype tibia Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Clade: Dinosauria Clade: Saurischia Clade: Theropoda Clade: †Ornithomimosauria Family: †Ornithomimidae Species: †Coelosaurus antiquus Binomial name Coelosaurus antiquus Synonyms Ornithomimus antiquus (Leidy, 1865) Coelosaurus antiquus (antique hollow lizard) is a…

RAY redirects here. For other uses, see Ray. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Finland's Slot Machine Association – news · newspapers · books · scholar · JSTOR (July 2021) (Learn how and when to remove this message) You can help expand this article with text translated from the corresponding artic…

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynasty786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][7] Eas…

German footballer (born 1966) Marcus Marin Marin in 1997Personal informationDate of birth (1966-12-13) 13 December 1966 (age 57)Place of birth Hamburg, West GermanyHeight 1.83 m (6 ft 0 in)Position(s) StrikerYouth career TSV Glinde VfL Lohbrügge TSV ReinbekSenior career*Years Team Apps (Gls)1985–1986 Hummelsbütteler SV 1986–1988 Hamburger SV II 1988–1990 Hamburger SV 15 (0)1990–1992 Stuttgarter Kickers 69 (35)1992–1993 1. FC Kaiserslautern 40 (9)1994 → FC St. Pa…

Questa voce sull'argomento psicologi statunitensi è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Questa voce o sezione sull'argomento psicologia è priva o carente di note e riferimenti bibliografici puntuali. Sebbene vi siano una bibliografia e/o dei collegamenti esterni, manca la contestualizzazione delle fonti con note a piè di pagina o altri riferimenti precisi che indichino puntualmente la provenienza delle informazioni. Puoi migliorare questa…

This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (April 2022) (Learn how and when to remove this message) Town in MaltaMarsalfornTownMotto: Tranquillitatis PlanissimusBordersŻebbuġ, Victoria, XagħraArea • Total0.2 km2 (0.08 sq mi)Population • Total750 • Estimate (n/a)500 to 1,000Time zoneUTC+ 1 (CET)&…

Aluminium monochloride Names IUPAC name Chloridoaluminium[1] Other names Aluminium(I) chloride[citation needed] Identifiers CAS Number 13595-81-8 Y 3D model (JSmol) Interactive image ChEBI CHEBI:30131 Y ChemSpider 4514257 Y PubChem CID 5359282 CompTox Dashboard (EPA) DTXSID40159602 InChI InChI=1S/Al.ClH/h;1H/q+1;/p-1 YKey: IZMHKHHRLNWLMK-UHFFFAOYSA-M Y SMILES [Al]Cl Properties Chemical formula AlCl Molar mass 62.43 g·mol−1 Thermochemis…

2006 single by Eminem featuring 50 Cent, Lloyd Banks and Ca$hisYou Don't KnowSingle by Eminem featuring 50 Cent, Lloyd Banks and Ca$hisfrom the album Eminem Presents: The Re-Up ReleasedNovember 7, 2006 (US)December 11, 2006 (UK)Recorded2006GenreGangsta raphardcore hip hopLength4:17LabelShadyInterscopeSongwriter(s)Marshall MathersCurtis JacksonChristopher LloydRamone JohnsonLuis RestoProducer(s)EminemLuis Resto (add.)Eminem singles chronology Smack That (2006) You Don't Know (2006) Jimmy Crac…