Share to: share facebook share twitter share wa share telegram print page

Alethinophidia

Alethinophidia
Temporal range: 94–0 Ma Cenomanian to Present[1]
Grass snake, Natrix natrix
Scientific classification Edit this classification
Domain: Eukaryota
Kingdom: Animalia
Phylum: Chordata
Class: Reptilia
Order: Squamata
Suborder: Serpentes
Infraorder: Alethinophidia
Nopcsa, 1923
Subclades
Common names: advanced snakes.

The Alethinophidia are an infraorder of snakes that includes all snakes other than blind snakes and thread snakes. Snakes have long been grouped into families within Alethinophidia based on their morphology, especially that of their teeth. More modern phylogenetic hypotheses using genetic data[2][3][4][5][6][7][8][9][10][11][excessive citations] support the recognition of 19 extant families (see below), although the taxonomy of alethinophidian snakes has long been debated, and ultimately the decision whether to assign a particular clade to a particular Linnaean rank (such as a superfamily, family, or subfamily) is arbitrary.

Etymology

The infraorder name Alethinophidia derives from the two Ancient Greek words ἀληθινός (alēthinós), meaning "truthful, genuine", and ὄφις (óphis), meaning "snake".[12][13]

Fossil record

Fossils of alethinophidians were found in Cenomanian (Middle Cretaceous) sites of Wadi Milk Formation in Wadi Abu Hashim, Sudan.[1] Coniophis presents the vertebral morphology similar to modern-day Aniliidae. Two extinct families from the same location, the Anomalophiidae and Russellophiidae, also belong to the Alethinophidia. Krebsophis is the earliest russellophiid. The family Nigerophiidae includes both aquatic[1] Nubianophis from Wadi Abu Hashim and Nigerophis from the Palaeocene of Niger. The genus Eoanilius (belongs to Aniliidae) appeared in the Eocene. It is also existed in Oligocene and early Miocene.[1] The extinct marine Simoliophidae are known from the Cenomanian of North Africa, the Middle East, and Eastern Europe, indicating a Tethyan distribution; they are notable for preserving evidence of vestigial hindlimbs.[14]

Systematics

Extant taxa

Fossil taxa

Based on Gower & Zaher (2022):[16]

See also

References

  1. ^ a b c d J.-C. Rage and C. Werner. 1999."Mid-Cretaceous (Cenomanian) snakes from Wadi Abu Hashim, Sudan: The earliest snake assemblage". 35, 85-110
  2. ^ "Alethinophidia". Integrated Taxonomic Information System. Retrieved 14 May 2018.
  3. ^ Pyron, R. A.; Burbrink, F.; Wiens, J. J. (2013). "A phylogeny and revised classification of Squamata, including 4161 species of lizards and snakes". BMC Evolutionary Biology. 13 (1): 93. Bibcode:2013BMCEE..13...93P. doi:10.1186/1471-2148-13-93. PMC 3682911. PMID 23627680.
  4. ^ Reynolds, RG; Niemiller, ML; Revell, LJ (2014). "Toward a Tree-of-Life for the boas and pythons: multilocus species-level phylogeny with unprecedented taxon sampling" (PDF). Molecular Phylogenetics and Evolution. 71: 201–213. doi:10.1016/j.ympev.2013.11.011. PMID 24315866. Archived from the original (PDF) on 2015-12-02. Retrieved 2018-05-14.
  5. ^ Streicher, J. W.; Ruane, S. (2018). "Phylogenomics of Snakes". eLS: 1–8. doi:10.1002/9780470015902.a0027476. ISBN 9780470015902.
  6. ^ Figueroa, A.; McKelvy, A. D.; Grismer, L. L.; Bell, C. D.; Lailvaux, S. P. (2016). "A species-level phylogeny of extant snakes with description of a new colubrid subfamily and genus". PLOS ONE. 11 (9): e0161070. Bibcode:2016PLoSO..1161070F. doi:10.1371/journal.pone.0161070. PMC 5014348. PMID 27603205.
  7. ^ Zheng, Y; Wiens, JJ (2016). "Combining phylogenomic and supermatrix approaches, and a time-calibrated phylogeny for squamate reptiles (lizards and snakes) based on 52 genes and 4162 species" (PDF). Molecular Phylogenetics and Evolution. 94 (Pt B): 537–547. doi:10.1016/j.ympev.2015.10.009. PMID 26475614.
  8. ^ Scanlon, J. D.; Lee, M. S. Y. (2011). Aldridge, R. D.; Sever, D. M. (eds.). The Major Clades of Living Snakes: Morphological Evolution, Molecular Phylogeny, and Divergence Dates in Reproductive Biology and Phylogeny of Snakes. Enfield, NH: Science Publishers. pp. 55–95.
  9. ^ Vidal, N.; Delmas, A. S.; Hedges, S. B. (2007). Henderson, R. W.; Powell, R. (eds.). The higher-level relationships of alethinophidian snakes inferred from seven nuclear and mitochondrial genes. Eagle Mountain, Utah, USA: Eagle Mountain Publishing. pp. 27–33.
  10. ^ Vitt, L. J.; Caldwell, J. P. (2014). Herpetology: an introductory biology of amphibians and reptiles (4th ed.). Burlington: Academic Press. pp. 108–109.
  11. ^ Uetz, Peter. "Serpentes at The Reptile Database". The Reptile Database. EMBL. Retrieved 14 May 2018.
  12. ^ Bailly, Anatole (1981-01-01). Abrégé du dictionnaire grec français. Paris: Hachette. ISBN 978-2010035289. OCLC 461974285.
  13. ^ Bailly, Anatole. "Greek-french dictionary online". www.tabularium.be. Retrieved January 7, 2019.
  14. ^ Hsiang, Allison Y.; Field, Daniel J.; Webster, Timothy H.; Behlke, Adam DB; Davis, Matthew B.; Racicot, Rachel A.; Gauthier, Jacques A. (2015-05-20). "The origin of snakes: revealing the ecology, behavior, and evolutionary history of early snakes using genomics, phenomics, and the fossil record". BMC Evolutionary Biology. 15 (1): 87. Bibcode:2015BMCEE..15...87H. doi:10.1186/s12862-015-0358-5. ISSN 1471-2148. PMC 4438441. PMID 25989795.
  15. ^ "Search results | The Reptile Database". reptile-database.reptarium.cz. Retrieved 2022-07-21.
  16. ^ Gower, David J.; Zaher, Hussam (2022-08-11). The Origin and Early Evolutionary History of Snakes. Cambridge University Press. p. 58. doi:10.1017/9781108938891.027.{{cite book}}: CS1 maint: date and year (link)

Read other articles:

AchmadSebagai anggota DPR-RI, tahun 2019 Anggota DPR-RI Dapil Riau 1Masa jabatan1 Oktober 2019 – petahanaPresidenJoko WidodoKetua DPRPuan Maharani[[Bupati Rokan Hulu]] ke-4Masa jabatan2011 – 2016PresidenSusilo Bambang Yudhoyono Joko WidodoGubernurRusli Zainal[[Wakil Bupati Rokan Hulu|Wakil]]Hafith Syukri PenggantiSuparmanMasa jabatan2006 – 2011PresidenSusilo Bambang YudhoyonoGubernurSaleh DjasitWakilSukiman PendahuluRamlan ZasPenggantiPetahana Informasi priba…

2016 single by Lindsey StirlingThe ArenaSingle by Lindsey StirlingReleased28 June 2016Genre Dubstep classical crossover electro house EDM Length3:53LabelLindseystomp RecordsSongwriter(s)Lindsey Stirling, Taylor Bird, Peter HannaProducer(s)RUMORSLindsey Stirling singles chronology Hallelujah (2015) The Arena (2016) Something Wild (2016) The Arena is a 2016 single released by violinist Lindsey Stirling. Background The Arena is the third track and first single from the album Brave Enough. The i…

Halaman ini berisi artikel tentang santo abad ke-2. Untuk santo abad ke-6, lihat Santo Eustase. Untuk santo Lithuania, lihat Antonus, Yohanes, dan Eustathios. Untuk kepala biara Luxeuil, lihat Eustace dari Luxeuil. Santo EustakhiusIkon Ortodoks Yunani St. EustathiosMartyrsMeninggal118 MasehiDihormati diGereja Anglikan; Gereja Katolik Roma; Gereja Ortodoks TimurPesta20 September (Gereja Barat, Ortodoks Timur)Atributkerbau; salib; tanduk; pembakaran; pemangganganPelindungmelawan api; keadaan sulit…

Adzan Tri BudimanKebangsaanIndonesiaNama lainChef AdzanPekerjaanJuru masak (chef) dan pengusahaDikenal atasAhli kuliner Adzan Tri Budiman, lebih dikenal dengan nama Chef Adzan adalah seorang ahli kuliner dan pengusaha Indonesia.[1][2] Ia bersama adiknya, Reno Andam Suri, ikut terlibat dalam pembuatan film Tabula Rasa sebagai penasihat kuliner.[3] Chef Adzan pernah bekerja pada Hyatt Hotel Group selama sepuluh tahun, dan terakhir ia dipercaya sebagai Executive Chef Hy…

Historic district in Iowa, United States United States historic placeHighland Historic DistrictU.S. National Register of Historic PlacesU.S. Historic district 214 Highland Blvd.Show map of IowaShow map of the United StatesLocationRoughly bounded by Independence Ave. and Steely, Idaho, and Vine Sts., Waterloo, IowaCoordinates42°30′01″N 92°18′42″W / 42.50028°N 92.31167°W / 42.50028; -92.31167Area64 acres (26 ha)ArchitectMortimer B. ClevelandArchitectural…

Roman Catholic church in Laguna, Philippines Church in Laguna, PhilippinesPila ChurchSt. Anthony of Padua ParishNational Shrine of St. Anthony of PaduaSantuario Nacional de San Antonio de Padua (Spanish)Pambansang Dambana ng San Antonio de Padua (Filipino)Church facade in 2015Pila ChurchShow map of LagunaPila ChurchShow map of LuzonPila ChurchShow map of Philippines14°14′02″N 121°21′52″E / 14.233958°N 121.364398°E / 14.233958; 121.364398LocationPobla…

Museum of the Meiji Restoration維新ふるさと館LocationKagoshima CityAccreditationKagoshima Tourism Convention AssociationKey holdingsArtifacts relevant to the Meiji RestorationVisitors157, 351 (2015)Websitehttp://www.ishinfurusatokan.info/ The Museum of the Meiji Restoration (維新ふるさと館, Ishin-furusato-kan) is a history museum in Kagoshima, Japan. Located by the Kōtsuki River, it is a gallery where visitors can learn about the Meiji Restoration. In the basement hall, sound, lig…

Felix von HartmannKardinal, Uskup Agung KolnGerejaKatolik RomaKeuskupan agungKolnAwal masa jabatan19 April 1913Masa jabatan berakhir11 November 1919PendahuluAnton Hubert FischerPenerusKarl Joseph SchulteJabatan lainKardinal-Imam San Giovanni a Porta LatinaImamatTahbisan imam19 Desember 1874Tahbisan uskup26 Oktober 1911Pelantikan kardinal25 Mei 1914oleh Pius XPeringkatKardinal-ImamInformasi pribadiLahir(1851-12-15)15 Desember 1851Münster, JermanWafat11 November 1919(1919-11-11) (umur 67)Kol…

Sébastien TurgotSébastien Turgot lors des Quatre Jours de Dunkerque 2011InformationsNaissance 11 avril 1984 (39 ans)LimogesNationalité françaiseSpécialité Rouleur[1]-Sprinter[2] Classiques flandriennes[3]Équipes amateurs 2003Nantes 442004-2005VC St Jean de Monts2006-2007Vendée U2017US Saint-HerblainÉquipes professionnelles 08.2006-12.2006Bouygues Telecom (stagiaire)2008Bouygues Telecom2009-2010BBox Bouygues Telecom2011-2013Europcar2014-2016AG2R La MondialePrincipales victoires 2 ch…

Article principal : Configuration d'aile. Le Curtiss P-40 Warhawk, monoplan à ailes basses. Un monoplan est un aéronef n'ayant qu'une seule paire d'ailes comme plan de sustentation[1]. Depuis la fin des années 1930, la plupart des aéronefs adoptent cette configuration, alors que les multi-plans étaient jusqu'alors privilégiées. L'amélioration constante et l'augmentation de puissance des motorisations ont en effet permis de compenser la diminution de portance liée à la diminution d…

Scottish Cup 2014-2015William Hill Scottish Cup 2014-2015 Competizione Scottish Cup Sport Calcio Edizione 130ª Date dal 16 agosto 2014al 30 maggio 2015 Luogo  Scozia Partecipanti 90 Risultati Vincitore  Inverness(1º titolo) Secondo  Falkirk Semi-finalisti  Celtic Hibernian Statistiche Incontri disputati 105 Gol segnati 369 (3,51 per incontro) Cronologia della competizione 2013-14 2015-16 Manuale La Scottish Cup 2014-15 è stata la 130ª edizione del torneo…

Синелобый амазон Научная классификация Домен:ЭукариотыЦарство:ЖивотныеПодцарство:ЭуметазоиБез ранга:Двусторонне-симметричныеБез ранга:ВторичноротыеТип:ХордовыеПодтип:ПозвоночныеИнфратип:ЧелюстноротыеНадкласс:ЧетвероногиеКлада:АмниотыКлада:ЗавропсидыКласс:Птиц…

Questa voce sull'argomento stagioni delle società calcistiche italiane è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Voce principale: Unione Sportiva Pergolettese 1932. Unione Sportiva Pergocrema 1932Stagione 1976-1977Sport calcio Squadra Pergocrema Allenatore Giorgio Veneri Presidente Arnaldo Rimoldi Serie C15º posto nel girone A. Maggiori presenzeCampionato: Foresti (38) Miglior marcatoreCampion…

Katharine Martha Houghton Hepburn Katharine Martha Houghton Hepburn (2 Februari 1878 – 17 Maret 1951) adalah seorang pelopor reformisme, feminisme dan hak suara perempuan di Amerika Serikat. Hepburn awalnya memiliki jabatan sebagai presiden Asosiasi Hak Pilih Wanita Connecticut. Kemudian ia bergabung dengan Partai Wanita Nasional.[1] Hepburn kemudian mendirikan sebuah organisasi bersama dengan Margaret Sanger yang bernama Planned Parenthood.[2] Ibu dari Hepburn merupakan se…

TeslaUn solenoide attraversato da una corrente elettrica di intensità costante genera un vettore campo magnetico misurabile in T.Informazioni generaliSistemaSI (unità derivata) Grandezzacampo magnetico SimboloT EponimoNikola Tesla In unità base SIkg × s−2 × A−1 Modifica dati su Wikidata · Manuale Il tesla (simbolo T) è un'unità di misura derivata del sistema internazionale (SI). Viene utilizzata per misurare l'induzione magnetica, ossia la densità del flusso magnetico.&…

Indian artist (born 1925) Krishen KhannaKhanna in 2011Born (1925-07-05) 5 July 1925 (age 98)Lyallpur, Punjab ProvinceKnown forPaintingAwardsPadma Bhushan (2011) Padma Shri (1990) Krishen Khanna (born 5 July 1925) is an Indian artist. He attended Imperial Service College in England and is a self-taught artist.[1] He is recipient of the Rockefeller Fellowship in 1962, the Padma Shri in 1990, and the Padma Bhushan in 2011.[2] Early life and education Khanna was born on 5 J…

Painting by Paolo Veronese Supper at EmmausItalian: Cena in Emmaus, French: Les Pèlerins d'EmmaüsArtistPaolo VeroneseYearcirca 1559–1560[1]Mediumoil on canvasSubjectRoad to Emmaus appearanceDimensions241 cm × 415 cm (7.91 ft × 13.62 ft)LocationLouvre, ParisOwnerGovernment of France Supper at Emmaus (Cena in Emmaus) is a painting by Italian Renaissance artist Paolo Veronese. At the Louvre, where it is housed, it is known as Les Pèlerins d'E…

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynasty786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][7] Eas…

University in Vallam Thanjavur, India This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Ponnaiyah Ramajayam Institute of Science and Technology – news · newspapers · books · scholar · JSTOR (June 2013) (Learn how and when to remove this message) PRISTMottoQuality and DisciplineTypePrivateEstablished1994Chancellor…

American politician This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (March 2013) (Learn how and when to remove this message) Walter CappsMember of the U.S. House of Representativesfrom California's 22nd districtIn officeJanuary 3, 1997 – October 28, 1997Preceded byAndrea SeastrandSucceeded byLois Capps Personal detailsBorn(1934-05-05)May 5,…

Kembali kehalaman sebelumnya