User:RememberOrwell/API
User:RememberOrwell/API/Header
Main module
- Source: MediaWiki
- License: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Which action to perform. This parameter should be sent as part of the request URL (not the POST body) for ease of use in debugging, analytics, and request routing or filtering.
- abusefiltercheckmatch
- Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
- abusefilterchecksyntax
- Check syntax of an AbuseFilter filter.
- abusefilterevalexpression
- Evaluates an AbuseFilter expression.
- abusefilterunblockautopromote
- Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- abuselogprivatedetails
- View private details of an AbuseLog entry.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- Check a username against AntiSpoof's normalisation checks.
- block
- Block a user.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Clears the
hasmsgflag for the current user. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Get the difference between two pages.
- createaccount
- Create a new user account.
- createlocalaccount
- Forcibly create a local account. The central account must exist.
- cxdelete
- Delete a draft translation created using the Content Translation extension.
- cxtoken
- Get JWT tokens to authenticate with cxserver.
- delete
- Delete a page.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Post a message on a discussion page.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Get the subscription statuses of given topics.
- discussiontoolssubscribe
- Subscribe (or unsubscribe) to receive notifications about a topic.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Create and edit pages.
- editmassmessagelist
- Edit a mass message delivery list.
- emailuser
- Email a user.
- expandtemplates
- Expands all templates within wikitext.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revert a file to an old version.
- flagconfig
- Get basic information about review flag configuration for this site.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- growthmanagementorlist
- Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
- growthmentordashboardupdatedata
- Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
- growthsetmenteestatus
- Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
- growthsetmentor
- Set user's mentor. Change will be publicly logged.
- growthstarmentee
- Mark or unmark a mentee as starred by current user (stored privately and not logged)
- help
- Display help for the specified modules.
- homepagequestionstore
- Obtain formatted questions posted via homepage modules
- imagerotate
- This module has been disabled.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- massmessage
- Send a message to a list of pages.
- mergehistory
- Merge page histories.
- move
- Move a page.
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- pagetriageaction
- Mark an article as reviewed or unreviewed.
- pagetriagelist
- Get a list of page IDs for building a PageTriage queue.
- pagetriagestats
- Get the stats for page triage.
- pagetriagetagcopyvio
- Tag a revision as a likely copyright violation.
- pagetriagetagging
- Add tags to an article.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- review
- Review a revision by approving or de-approving it.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Shorten a long URL into a shorter one.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- stabilize
- Configure review-protection settings for a page.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- sxdelete
- Delete the draft section translation and its parallel corpora from database.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Returns a webapp manifest.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- wikilove
- Give WikiLove to another user.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Check for validation errors in the given content
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- cxcheckunreviewed
- Internal. Check if any fast, unreviewed translation has been published recently for the current user.
- cxfavoritesuggestions
- Internal. Add or remove a favorite suggestion to the current user's list.
- cxpublish
- Internal. Save a page created using the Content Translation extension.
- cxpublishsection
- Internal. Save a section created using the Content Translation extension's section translation feature.
- cxsave
- Internal. This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.
- cxsplit
- Internal. Create and save a section translation to database, for every translated section of the given article translation
- discussiontoolscompare
- Internal. Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- Internal. Returns metadata required to initialize the discussion tools.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- echopushsubscriptions
- Internal. Manage push subscriptions for the current user.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Get a new FancyCaptcha.
- growthinvalidateimagerecommendation
- Internal. Invalidate an image recommendation.
- growthinvalidatepersonalizedpraisesuggestion
- Internal. Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
- growthinvalidaterevisetonerecommendation
- Internal. Drop a 'Revise Tone' recommendation for a given page.
- helppanelquestionposter
- Internal. Handle questions posted via the help panel for the current user.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Internal. Parse a page with two different parser configurations.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- sxsave
- Internal. Save the draft section translation and store the parallel corpora
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- ulslocalization
- Internal. Get the localization of ULS in the given language.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, cxdelete, cxtoken, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, flagconfig, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, growthmanagementorlist, growthmentordashboardupdatedata, growthsetmenteestatus, growthsetmentor, growthstarmentee, help, homepagequestionstore, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, pagetriageaction, pagetriagelist, pagetriagestats, pagetriagetagcopyvio, pagetriagetagging, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, review, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, stabilize, streamconfigs, strikevote, sxdelete, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, wikilove, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, cxcheckunreviewed, cxfavoritesuggestions, cxpublish, cxpublishsection, cxsave, cxsplit, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, echopushsubscriptions, editcheckreferenceurl, fancycaptchareload, growthinvalidateimagerecommendation, growthinvalidatepersonalizedpraisesuggestion, growthinvalidaterevisetonerecommendation, helppanelquestionposter, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, sxsave, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Default: help
- format
The format of the output.
- One of the following values: json, jsonfm, none, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- Type: integer
- smaxage
Set the
s-maxageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Set the
max-ageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.
- One of the following values: anon, bot, user
- assertuser
Verify the current user is the named user.
- Type: user, by any of username and Temporary user
- requestid
Any value given here will be included in the response. May be used to distinguish requests.
- servedby
Include the hostname that served the request in the results.
- Type: boolean (details)
- curtimestamp
Include the current timestamp in the result.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Wikitext with HTML tags removed and entities replaced.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Message key and parameters.
- none
- No text output, only the error codes.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- One of the following values: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Help for the main module.
- api.php?action=help [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
action=abusefiltercheckmatch
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
vars, rcid or logid is required however only one may be used.
- filter
The full filter text to check for a match.
- This parameter is required.
- vars
JSON encoded array of variables to test against.
- rcid
Recent change ID to check against.
- Type: integer
- logid
Edit filter log ID to check against.
- Type: integer
- Test if recent change ID 15 matches a simple filter
- api.php?action=abusefiltercheckmatch&filter=!("autoconfirmed"%20in%20user_groups)&rcid=15 [open in sandbox]
action=abusefilterchecksyntax
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Check syntax of an AbuseFilter filter.
- filter
The full filter text to check syntax on.
- This parameter is required.
- Check syntax of a valid filter
- api.php?action=abusefilterchecksyntax&filter="foo" [open in sandbox]
- Check syntax of an invalid filter
- api.php?action=abusefilterchecksyntax&filter="bar"%20bad_variable [open in sandbox]
action=abusefilterevalexpression
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Evaluates an AbuseFilter expression.
- expression
The expression to evaluate.
- This parameter is required.
- prettyprint
Whether the result should be pretty-printed.
- Type: boolean (details)
- Evaluate a simple expression
- api.php?action=abusefilterevalexpression&expression=lcase("FOO") [open in sandbox]
- Evaluate a simple expression, formatting the result
- api.php?action=abusefilterevalexpression&expression=lcase("FOO")&prettyprint=1 [open in sandbox]
action=abusefilterunblockautopromote
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- user
Username of the user you want to unblock.
- This parameter is required.
- Type: user, by username
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Remove the block on User:Example's autopromotion
- api.php?action=abusefilterunblockautopromote&user=Example&token=123ABC [open in sandbox]
action=abuselogprivatedetails
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Abuse Filter
- License: GPL-2.0-or-later
View private details of an AbuseLog entry.
- logid
The ID of the AbuseLog entry to be checked.
- Type: integer
- reason
A valid reason for performing the check.
- Default: (empty)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Get private details for the AbuseLog entry with ID 1, using the reason "example".
- api.php?action=abuselogprivatedetails&logid=1&reason=example&token=ABC123 [open in sandbox]
action=acquiretempusername
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
If the user later performs an action that results in temp account creation, the stashed username will be used for their account. It may also be used in previews. However, the account is not created yet, and the name is not visible to other users.
action=antispoof
- This module requires read rights.
- Source: AntiSpoof
- License: GPL-2.0-or-later
Check a username against AntiSpoof's normalisation checks.
- username
The username to check against AntiSpoof.
- This parameter is required.
- Check username "Foo" against AntiSpoof
- api.php?action=antispoof&username=Foo [open in sandbox]
action=block
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Block a user.
- id
ID of the block to modify (obtained through list=blocks). Cannot be used together with user, reblock, or newblock.
- Type: integer
- user
User to block. Cannot be used together with id.
- Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- expiry
Expiry time. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If set to infinite, indefinite, or never, the block will never expire.
- Default: never
- reason
Reason for block.
- Default: (empty)
- anononly
Block anonymous users only (i.e. disable anonymous edits for this IP address, including temporary account edits).
- Type: boolean (details)
- nocreate
Prevent account creation.
- Type: boolean (details)
- autoblock
Automatically block the last used IP address, and any subsequent IP addresses they try to login from.
- Type: boolean (details)
- noemail
Prevent user from sending email through the wiki. (Requires the
blockemailright).- Type: boolean (details)
- hidename
Hide the username from the block log. (Requires the
hideuserright).- Type: boolean (details)
- allowusertalk
Allow the user to edit their own talk page (depends on $wgBlockAllowsUTEdit).
- Type: boolean (details)
- reblock
If the user is already blocked by a single block, overwrite the existing block. If the user is blocked more than once, this will fail—use the id parameter instead to specify which block to overwrite. Cannot be used together with id or newblock.
- Type: boolean (details)
- newblock
Add another block even if the user is already blocked. Cannot be used together with id or reblock.
- Type: boolean (details)
- watchuser
Watch the user's or IP address's user and talk pages.
- Type: boolean (details)
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
Change tags to apply to the entry in the block log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- partial
Block user from specific pages or namespaces rather than the entire site.
- Type: boolean (details)
- pagerestrictions
List of titles to block the user from editing. Only applies when partial is set to true.
- Type: page title
- Separate values with | or alternative.
- Maximum number of values is 50.
- Only accepts pages that exist.
- namespacerestrictions
List of namespace IDs to block the user from editing. Only applies when partial is set to true.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- actionrestrictions
List of actions to block the user from performing. Only applies when partial is set to true.
- Values (separate with | or alternative): create, move, thanks, upload
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Block IP address 192.0.2.5 for three days with a reason.
- api.php?action=block&user=192.0.2.5&expiry=3%20days&reason=First%20strike&token=123ABC [open in sandbox]
- Block user Vandal indefinitely with a reason, and prevent new account creation and email sending.
- api.php?action=block&user=Vandal&expiry=never&reason=Vandalism&nocreate=&autoblock=&noemail=&token=123ABC [open in sandbox]
action=bouncehandler
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: BounceHandler
- License: GPL-2.0-or-later
Receive a bounce email and process it to handle the failing recipient.
The bounced email.
- This parameter is required.
- Receive a bounce email for processing with the content "This is a test email".
- api.php?action=bouncehandler&email=This%20is%20a%20test%20email [open in sandbox]
action=categorytree
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CategoryTree
- License: GPL-2.0-or-later
Internal module for the CategoryTree extension.
- category
Title in the category namespace, prefix will be ignored if given.
- This parameter is required.
- options
Options for the CategoryTree constructor as a JSON object. The depth option defaults to 1.
action=centralauthtoken
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Fetch a centralauthtoken for making an authenticated request to an attached wiki.
Returns a token that can be use to authenticate API requests on other wikis. For action API requests, put it in the centralauthtoken GET parameter. For REST API requests, add an Authorization: CentralAuthToken {token} header. In MediaWiki frontend logic, you can use the mediawiki.ForeignApi ResourceLoader module.
This wiki is configured to return a JSON Web Token from this API.
- Fetch a centralauthtoken
- api.php?action=centralauthtoken [open in sandbox]
action=centralnoticecdncacheupdatebanner
- This module requires read rights.
- This module only accepts POST requests.
- Source: CentralNotice
- License: GPL-2.0-or-later
Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
Name of the banner whose content should be purged
- This parameter is required.
Language of the banner content to purge
- This parameter is required.
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Purge the content of 'Banner1' from CDN cache, for English
- api.php?action=centralnoticecdncacheupdatebanner&token=ABC123&banner=Banner1&language=en [open in sandbox]
action=centralnoticechoicedata
- This module requires read rights.
- Source: CentralNotice
- License: GPL-2.0-or-later
Get data needed to choose a banner for a given project and language
- project
The project to get banner choice data for.
- This parameter is required.
- language
The language to get banner choice data for.
- This parameter is required.
- Get the data for choosing a banner for English Wikipedia users.
- api.php?action=centralnoticechoicedata&project=wikipedia&language=en [open in sandbox]
action=centralnoticequerycampaign
- This module requires read rights.
- Source: CentralNotice
- License: GPL-2.0-or-later
Get all configuration settings for a campaign.
- campaign
Campaign name. Separate multiple values with a "|" (vertical bar).
- This parameter is required.
- Show campaign "Plea_US"
- api.php?action=centralnoticequerycampaign&format=json&campaign=Plea_US [open in sandbox]
action=changeauthenticationdata (changeauth)
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change authentication data for the current user.
- changeauthrequest
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=change.
- This parameter is required.
- changeauthtoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=change (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Attempt to change the current user's password to ExamplePassword.
- api.php?action=changeauthenticationdata&changeauthrequest=MediaWiki%5CAuth%5CPasswordAuthenticationRequest&password=ExamplePassword&retype=ExamplePassword&changeauthtoken=123ABC [open in sandbox]
action=changecontentmodel
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the content model of a page
- title
Title of the page to change the contentmodel of. Cannot be used together with pageid.
- pageid
Page ID of the page to change the contentmodel of. Cannot be used together with title.
- Type: integer
- summary
Edit summary and log entry reason
Change tags to apply to the log entry and edit.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- model
Content model of the new content.
- This parameter is required.
- One of the following values: GadgetDefinition, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, vue, wikitext
- bot
Mark the content model change with a bot flag.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Change the main page to have the
textcontent model - api.php?action=changecontentmodel&title=Main Page&model=text&token=123ABC [open in sandbox]
action=chartinfo
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Chart
- License: GPL-3.0-or-later
Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- global
Set to true to include all connected wikis instead of the local wiki only.
- Type: boolean (details)
- Fetch of the local wiki's charts count.
- api.php?action=chartinfo&formatversion=2&format=jsonfm [open in sandbox]
- Fetch of all wikis' charts count.
- api.php?action=chartinfo&global=0&formatversion=2&format=jsonfm [open in sandbox]
action=checktoken
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Check the validity of a token from action=query&meta=tokens.
- type
Type of token being tested.
- This parameter is required.
- One of the following values: createaccount, csrf, deleteglobalaccount, login, patrol, rollback, setglobalaccountstatus, userrights, watch
- token
Token to test.
- This parameter is required.
- maxtokenage
Maximum allowed age of the token, in seconds.
- Type: integer
- Test the validity of a csrf token.
- api.php?action=checktoken&type=csrf&token=123ABC [open in sandbox]
action=cirrus-check-sanity
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Reports on the correctness of a range of page ids in the search index
- cluster
The search cluster to check indices in
- This parameter is required.
- One of the following values: cloudelastic, codfw, eqiad
- from
Page id to start checking at
- This parameter is required.
- Type: integer
- The value must be no less than 0.
- limit
The number of page ids to check
- Type: integer or max
- The value must be between 1 and 500.
- Default: 100
- sequenceid
The number of times this set of page ids has been checked
- Type: integer
- rerenderfrequency
Number of checks after which a page should be rerendered. Based off the provided sequenceid.
- Type: integer
- The value must be no less than 2.
- Default: 16
action=cirrus-config-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch configuration.
- prop
Type of configuration variables to dump
- Values (separate with | or alternative): expectedindices, globals, namespacemap, profiles, replicagroup, usertesting
- Default: globals|namespacemap|profiles|replicagroup
- Get a dump of CirrusSearch configuration.
- api.php?action=cirrus-config-dump [open in sandbox]
action=cirrus-profiles-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch profiles for this wiki.
- verbose
Dump the profiles content
- Type: boolean (details)
- Get a dump of CirrusSearch profiles for this wiki.
- api.php?action=cirrus-profiles-dump [open in sandbox]
action=cirrus-schema-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch schema (settings and mappings) for this wiki.
- build
Whether to build the schema from code (true) or fetch from live cluster (false).
- Type: boolean (details)
- plugins
List of OpenSearch/Elasticsearch plugins available on the target cluster. Only used when build=true. If not provided, plugins will be detected from the connected cluster.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get a dump of CirrusSearch schema from the live cluster.
- api.php?action=cirrus-schema-dump [open in sandbox]
- Generate CirrusSearch schema from code configuration.
- api.php?action=cirrus-schema-dump&build=true [open in sandbox]
- Generate CirrusSearch schema with specific plugins enabled.
- api.php?action=cirrus-schema-dump&build=true&plugins=analysis-icu|extra-analysis-textify [open in sandbox]
action=clearhasmsg
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Clears the hasmsg flag for the current user.
- Clear the
hasmsgflag for the current user. - api.php?action=clearhasmsg [open in sandbox]
action=clientlogin (login)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log in to the wiki using the interactive flow.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=login, and a login token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying loginreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with logincontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to loginreturnurl. Then post to this module with logincontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- loginrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=login or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- loginmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- loginmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- loginpreservestate
Preserve state from a previous failed login attempt, if possible.
- Type: boolean (details)
- loginreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or logincontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a logincontinue request to this API module.
- logincontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or loginreturnurl is required.
- Type: boolean (details)
- loginreauthenticate
Instead of logging in, reauthenticate for getting temporary access to a security-sensitive operation. This must be done when already logged in, using the fields suplied by action=query&meta=authmanagerinfo when called with the amireauthenticate parameter. The value of the parameter should be the same as that of amireauthenticate.
- logintoken
A "login" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=login (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of logging in to the wiki as user Example with password ExamplePassword.
- api.php?action=clientlogin&username=Example&password=ExamplePassword&loginreturnurl=http://example.org/&logintoken=123ABC [open in sandbox]
- Continue logging in after a UI response for two-factor auth, supplying an OATHToken of 987654.
- api.php?action=clientlogin&logincontinue=1&OATHToken=987654&logintoken=123ABC [open in sandbox]
action=codemirror-validate
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CodeMirror
- License: GPL-2.0-or-later
Check for validation errors in the given content
- content
The text content to validate
- This parameter is required.
- contentmodel
Content model
- This parameter is required.
- One of the following values: Scribunto, javascript, sanitized-css
- title
Title of page the content belongs to.
- This parameter is required.
- Type: page title
- Accepts non-existent pages.
- Check if
h2 {color: red}is valid for sanitized-css - api.php?action=codemirror-validate&contentmodel=sanitized-css&content=h2 {color: red}&title=Template:X1/styles.css [open in sandbox]
action=collection
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for performing various operations on a wiki user's collection.
- submodule
Submodule for performing various operations on a wiki user's collection.
- addarticle
- API module for adding a page to the collection
- addcategory
- API module for adding pages from a given category to a user's collection.
- addchapter
- API module for adding a chapter to the collection
- clearcollection
- API module for clearing the collection and the suggestions
- getbookcreatorboxcontent
- API submodule for grabbing the box content of the user's book creator box special page.
- getcollection
- API module for listing the current pages in a collection
- getpopupdata
- API module to get data and HTML to construct a popup
- postcollection
- API module for posting pages to a user's collection
- removearticle
- API module for removing a page from the collection
- removeitem
- API module for removing an item from the collection index-wise via the Special:Book page.
- renamechapter
- API module for renaming a chapter in the user's collection
- setsorting
- API module for reordering items in a collection
- settitles
- API module for setting the collection's title, subtitle, and settings
- sortitems
- API module to sort pages in a collection alphabetically. Pages within chapters are grouped and sorted together.
- suggestarticleaction
- API module to interact with suggestions
- suggestundoarticleaction
- API module to undo actions done from suggestarticleaction
- This parameter is required.
- One of the following values: addarticle, addcategory, addchapter, clearcollection, getbookcreatorboxcontent, getcollection, getpopupdata, postcollection, removearticle, removeitem, renamechapter, setsorting, settitles, sortitems, suggestarticleaction, suggestundoarticleaction
- Submodule for performing various operations on a wiki user's collection.
- api.php?action=collection&submodule=getcollection [open in sandbox]
submodule=addarticle
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for adding a page to the collection
- namespace
Namespace of page to add
- This parameter is required.
- Type: integer
- title
Title of page to add
- This parameter is required.
- oldid
Oldid of page to add
- Type: integer
- Default: 0
- Add a page to the collection.
- api.php?action=collection&submodule=addarticle&namespace=0&title=Main_Page&oldid=0 [open in sandbox]
submodule=addcategory
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for adding pages from a given category to a user's collection.
- title
Category to add
- Default: (empty)
- Add pages from a given category to a user's collection.
- api.php?action=collection&submodule=addcategory&title=Main_Page [open in sandbox]
submodule=addchapter
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for adding a chapter to the collection
- chaptername
Name of chapter to add
- Default: (empty)
- Add a chapter to the collection.
- api.php?action=collection&submodule=addchapter&chaptername=Test [open in sandbox]
submodule=clearcollection
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for clearing the collection and the suggestions
- Clears collection and suggestions
- api.php?action=collection&submodule=clearcollection [open in sandbox]
submodule=getbookcreatorboxcontent
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API submodule for grabbing the box content of the user's book creator box special page.
- hint
Hint shown in the creator box
- Default: (empty)
- oldid
Oldid of a collection
- Type: integer
- pagename
Title of a page
- Get book creator box content of the user's collection.
- api.php?action=collection&submodule=getbookcreatorboxcontent&hint=Test&oldid=0&pagename=Page [open in sandbox]
submodule=getcollection
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for listing the current pages in a collection
- List pages currently in the collection.
- api.php?action=collection&submodule=getcollection [open in sandbox]
submodule=getpopupdata
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module to get data and HTML to construct a popup
- title
Title of a page
- This parameter is required.
- Gets a popup to add a page to the collection or to remove it
- api.php?action=collection&submodule=getpopupdata&title=foobar [open in sandbox]
submodule=postcollection
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for posting pages to a user's collection
- collection
Name of a collection
- Default: (empty)
- Post pages to a user's collection
- api.php?action=collection&submodule=postcollection&collection={"title":"BookTitle","items":[{"type":"article", "content_type":"text/x-wiki","title":"Test","revision":"1","latest":"1","timestamp":"1631548781", "url":"http://t.wiki/Test","currentVersion":1}]} [open in sandbox]
submodule=removearticle
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for removing a page from the collection
- namespace
Namespace of page to remove
- This parameter is required.
- Type: integer
- title
Title of page to remove
- This parameter is required.
- oldid
Oldid of page to remove
- Type: integer
- Default: 0
- Remove a page from the collection.
- api.php?action=collection&submodule=removearticle&namespace=0&title=Main_Page&oldid=0 [open in sandbox]
submodule=removeitem
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for removing an item from the collection index-wise via the Special:Book page.
- index
Index of item to remove
- Type: integer
- Default: 0
- Remove an item from the collection provided an index or index 0 by default.
- api.php?action=collection&submodule=removeitem&index=2 [open in sandbox]
submodule=renamechapter
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for renaming a chapter in the user's collection
- index
Index of chapter to rename
- This parameter is required.
- Type: integer
- chaptername
Name of chapter to rename
- This parameter is required.
- Rename a chapter in the user's collection.
- api.php?action=collection&submodule=renamechapter&index=2&chaptername=Renamed [open in sandbox]
submodule=setsorting
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for reordering items in a collection
- items
Items should be listed using their old index and ordered by their new position
- This parameter is required.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- In a collection of 3 items, swap the first and second item
- api.php?action=collection&submodule=setsorting&items=1|0|2 [open in sandbox]
- In a collection of 3 items, make the 3rd item first, and delete the 2nd item
- api.php?action=collection-setsorting&items=2|0 [open in sandbox]
submodule=settitles
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module for setting the collection's title, subtitle, and settings
- title
Title of the collection
- This parameter is required.
- subtitle
Subtitle of the collection
- Default: (empty)
- settings
Settings for the collection
- Default: (empty)
- Set the collection's title and subtitle
- api.php?action=collection&submodule=settitles&title=foo&subtitle=bar [open in sandbox]
- Set the collection's title, subtitle, and settings
- api.php?action=collection&submodule=settitles&title=foo&subtitle=bar&settings={"papersize":"a4","toc":"auto","columns":"2"} [open in sandbox]
submodule=sortitems
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module to sort pages in a collection alphabetically. Pages within chapters are grouped and sorted together.
- Sort collection pages alphabetically
- api.php?action=collection&submodule=sortitems [open in sandbox]
submodule=suggestarticleaction
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module to interact with suggestions
- suggestaction
One of 'add', 'remove', or 'ban'. 'add' adds a page to the collection and suggestions and unbans it. 'remove' removes an added page and bans it. 'ban' bans a page from suggestions.
- This parameter is required.
- One of the following values: add, ban, remove
- title
Title of a page
- This parameter is required.
- Adds a page to the collection and the suggestions
- api.php?action=collection&submodule=suggestarticleaction&suggestaction=add&title=Main_Page [open in sandbox]
submodule=suggestundoarticleaction
- This module requires read rights.
- Source: Collection
- License: GPL-2.0-or-later
API module to undo actions done from suggestarticleaction
- lastaction
One of 'add', 'remove', or 'ban'.
- This parameter is required.
- One of the following values: add, ban, remove
- title
Title of a page
- This parameter is required.
- Undoes an added page action
- api.php?action=collection&submodule=suggestundoarticleaction&lastAction=add&title=Main_Page [open in sandbox]
action=communityconfigurationedit
- This module requires read rights.
- This module only accepts POST requests.
- Source: CommunityConfiguration
- License: GPL-3.0-or-later
Change the content of a configuration provider in Community configuration
- provider
Provider key
- This parameter is required.
- One of the following values: Babel, BlockedDomain, CampaignEvents, CommunityUpdates, ContentTranslation, GrowthHomepage, GrowthMentorList, GrowthSuggestedEdits, HelpPanel, Mentorship, ReportIncident, TemplateData-FeaturedTemplates
- content
The current content of the provider will be replaced with this one. Use JSON to serialize the new content.
- This parameter is required.
- summary
Edit summary
- Default: (empty)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=compare
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get the difference between two pages.
A revision number, a page title, a page ID, text, or a relative reference for both "from" and "to" must be passed.
- fromtitle
First title to compare.
- fromid
First page ID to compare.
- Type: integer
- fromrev
First revision to compare.
- Type: integer
- fromslots
Override content of the revision specified by fromtitle, fromid or fromrev.
This parameter specifies the slots that are to be modified. Use fromtext-{slot}, fromcontentmodel-{slot}, and fromcontentformat-{slot} to specify content for each slot.
- Values (separate with | or alternative): main
- fromtext-{slot}
Text of the specified slot. If omitted, the slot is removed from the revision.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- fromsection-{slot}
When fromtext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by fromtitle, fromid or fromrev as if for a section edit.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- fromcontentformat-{slot}
Content serialization format of fromtext-{slot}.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- fromcontentmodel-{slot}
Content model of fromtext-{slot}. If not supplied, it will be guessed based on the other parameters.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- frompst
Do a pre-save transform on fromtext-{slot}.
- Type: boolean (details)
- fromtext
- Deprecated.
Specify fromslots=main and use fromtext-main instead.
- fromcontentformat
- Deprecated.
Specify fromslots=main and use fromcontentformat-main instead.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- fromcontentmodel
- Deprecated.
Specify fromslots=main and use fromcontentmodel-main instead.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- fromsection
- Deprecated.
Only use the specified section of the specified 'from' content.
- totitle
Second title to compare.
- toid
Second page ID to compare.
- Type: integer
- torev
Second revision to compare.
- Type: integer
- torelative
Use a revision relative to the revision determined from fromtitle, fromid or fromrev. All of the other 'to' options will be ignored.
- One of the following values: cur, next, prev
- toslots
Override content of the revision specified by totitle, toid or torev.
This parameter specifies the slots that are to be modified. Use totext-{slot}, tocontentmodel-{slot}, and tocontentformat-{slot} to specify content for each slot.
- Values (separate with | or alternative): main
- totext-{slot}
Text of the specified slot. If omitted, the slot is removed from the revision.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- tosection-{slot}
When totext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by totitle, toid or torev as if for a section edit.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- tocontentformat-{slot}
Content serialization format of totext-{slot}.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- tocontentmodel-{slot}
Content model of totext-{slot}. If not supplied, it will be guessed based on the other parameters.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- topst
Do a pre-save transform on totext.
- Type: boolean (details)
- totext
- Deprecated.
Specify toslots=main and use totext-main instead.
- tocontentformat
- Deprecated.
Specify toslots=main and use tocontentformat-main instead.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- tocontentmodel
- Deprecated.
Specify toslots=main and use tocontentmodel-main instead.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- tosection
- Deprecated.
Only use the specified section of the specified 'to' content.
- prop
Which pieces of information to get.
- diff
- The diff HTML.
- diffsize
- The size of the diff HTML, in bytes.
- rel
- The revision IDs of the revision previous to 'from' and after 'to', if any.
- ids
- The page and revision IDs of the 'from' and 'to' revisions.
- title
- The page titles of the 'from' and 'to' revisions.
- user
- The username and ID of the 'from' and 'to' revisions. If the user has been revision deleted, a fromuserhidden or touserhidden property will be returned.
- comment
- The comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
- parsedcomment
- The parsed comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
- size
- The size of the 'from' and 'to' revisions.
- timestamp
- The timestamp of the 'from' and 'to' revisions.
- Values (separate with | or alternative): comment, diff, diffsize, ids, parsedcomment, rel, size, timestamp, title, user
- Default: diff|ids|title
- slots
Return individual diffs for these slots, rather than one combined diff for all slots.
- Values (separate with | or alternative): main
- To specify all values, use *.
- difftype
Return the comparison formatted as inline HTML.
- One of the following values: inline, table, unified
- Default: table
- Create a diff between revision 1 and 2.
- api.php?action=compare&fromrev=1&torev=2 [open in sandbox]
action=createaccount (create)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Create a new user account.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=create, and a createaccount token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying createreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with createcontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to createreturnurl. Then post to this module with createcontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- createrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=create or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- createmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- createmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- createpreservestate
Preserve state from a previous failed login attempt, if possible.
If action=query&meta=authmanagerinfo returned true for hasprimarypreservedstate, requests marked as primary-required should be omitted. If it returned a non-empty value for preservedusername, that username must be used for the username parameter.
- Type: boolean (details)
- createreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or createcontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a createcontinue request to this API module.
- createcontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or createreturnurl is required.
- Type: boolean (details)
- createtoken
A "createaccount" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=create (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of creating the user Example with the password ExamplePassword.
- api.php?action=createaccount&username=Example&password=ExamplePassword&retype=ExamplePassword&createreturnurl=http://example.org/&createtoken=123ABC [open in sandbox]
action=createlocalaccount
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CentralAuth
- License: GPL-2.0-or-later
Forcibly create a local account. The central account must exist.
- username
User to create the local account for.
- This parameter is required.
- reason
Reason for creating the local account.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Forcibly create a local account for User:Example.
- api.php?action=createlocalaccount&username=Example&reason=Because+I+can [open in sandbox]
action=cspreport
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- reportonly
Mark as being a report from a monitoring policy, not an enforced policy
- Type: boolean (details)
- source
What generated the CSP header that triggered this report
- Default: internal
action=cxcheckunreviewed
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Check if any fast, unreviewed translation has been published recently for the current user.
action=cxdelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Delete a draft translation created using the Content Translation extension.
- from
The source language code.
- This parameter is required.
- to
The target language code.
- This parameter is required.
- sourcetitle
The title of the source page.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Delete a draft associated with given language pair and title.
- api.php?action=cxdelete&from=en&to=es&sourcetitle=Food [open in sandbox]
action=cxfavoritesuggestions
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Add or remove a favorite suggestion to the current user's list.
- listaction
Action to be performed on the given favorite suggestion title. Available options: 'add' and 'remove'
- This parameter is required.
- One of the following values: add, remove
- title
The title of the favorite suggestion on which the action should be performed
- This parameter is required.
- from
The source language of the favorite suggestion on which the action should be performed
- This parameter is required.
- to
The target language of the favorite suggestion on which the action should be performed
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Add a suggestion to the user's list of favorite suggestions
- api.php?action=cxfavoritesuggestions&listaction=add&title=Title&from=en&to=es [open in sandbox]
- Remove a suggestion from the user's list of favorite suggestions
- api.php?action=cxfavoritesuggestions&listaction=remove&title=Title&from=en&to=es [open in sandbox]
action=cxpublish
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Save a page created using the Content Translation extension.
- title
The title of the page to perform actions on.
- This parameter is required.
- html
The content to save.
- This parameter is required.
- from
The source language code.
- This parameter is required.
- to
The target language code.
- This parameter is required.
- sourcetitle
The title of the source page.
- This parameter is required.
- categories
The categories to put the published page in.
The edit tags to add to the published page.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wpCaptchaId
Captcha ID (when saving with a captcha response).
- wpCaptchaWord
Answer to the captcha (when saving with a captcha response).
- cxversion
Version of the editor used to publish the translation.
- This parameter is required.
- Type: integer
- The value must be between 1 and 2.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=cxpublishsection
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Save a section created using the Content Translation extension's section translation feature.
- title
The title of the page to perform actions on.
- This parameter is required.
- html
The content to save.
- This parameter is required.
- sourcelanguage
The source language code.
- This parameter is required.
- targetlanguage
The target language code.
- This parameter is required.
- sourcetitle
The title of the source page.
- This parameter is required.
- sourcerevid
The source page revision id.
- This parameter is required.
- sourcesectiontitle
The title of the source section.
- This parameter is required.
- targetsectiontitle
The title of the target section.
- This parameter is required.
- sectiontranslationid
The section translation id associated with the draft section translation.
- This parameter is required.
- Type: integer
- publishtarget
The publishing target of the section translation. Possible values: 'SANDBOX', 'NEW_SECTION', 'EXPAND' and 'REPLACE'.
- One of the following values: EXPAND, NEW_SECTION, REPLACE, SANDBOX
- existingsectiontitle
The title of the existing section that is going to be expanded.
- captchaid
Captcha ID (when saving with a captcha response).
- captchaword
Answer to the captcha (when saving with a captcha response).
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=cxsave
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.
- from
The source language code.
- This parameter is required.
- to
The target language code.
- This parameter is required.
- sourcetitle
The title of the source page.
- This parameter is required.
- title
The title of the page to perform actions on.
- This parameter is required.
- content
JSON-encoded section data. Each section is an object and has the following keys: content, sectionId, sequenceId, sequenceId, origin
- This parameter is required.
- sourcerevision
The revision of the source page.
- This parameter is required.
- Type: integer
- progress
Information about translation completion (progress). JSON with the keys
any,human,mtandmtSectionsCount. The keys' values are percentages.- This parameter is required.
- cxversion
Version of the editor used to create the draft translation.
- Type: integer
- The value must be between 1 and 2.
- sourcecategories
JSON encoded array of source categories to be saved with draft translation.
- Cannot be longer than 65,535 bytes.
- targetcategories
JSON encoded array of target categories to be saved with draft translation.
- Cannot be longer than 65,535 bytes.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=cxsplit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Create and save a section translation to database, for every translated section of the given article translation
- translationid
The id of the translation, for which the section translations will be created.
- This parameter is required.
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=cxtoken
- This module requires read rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get JWT tokens to authenticate with cxserver.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Fetch the authentication token for cxserver
- api.php?action=cxtoken&token=123ABC [open in sandbox]
action=delete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Delete a page.
- title
Title of the page to delete. Cannot be used together with pageid.
- pageid
Page ID of the page to delete. Cannot be used together with title.
- Type: integer
- reason
Reason for the deletion. If not set, an automatically generated reason will be used.
Change tags to apply to the entry in the deletion log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- deletetalk
Delete the talk page, if it exists.
- Type: boolean (details)
- watch
- Deprecated.
Add the page to the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- unwatch
- Deprecated.
Remove the page from the current user's watchlist.
- Type: boolean (details)
- oldimage
The name of the old image to delete as provided by action=query&prop=imageinfo&iiprop=archivename.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Delete Main Page.
- api.php?action=delete&title=Main%20Page&token=123ABC [open in sandbox]
- Delete Main Page with the reason Preparing for move.
- api.php?action=delete&title=Main%20Page&token=123ABC&reason=Preparing%20for%20move [open in sandbox]
action=deleteglobalaccount
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CentralAuth
- License: GPL-2.0-or-later
Delete a global user.
- user
User to delete.
- This parameter is required.
- reason
Reason for deleting the user.
- token
A "deleteglobalaccount" token retrieved from action=query&meta=tokens
- This parameter is required.
- Delete the global account for User:Example
- api.php?action=deleteglobalaccount&user=Example&reason=Because+I+can [open in sandbox]
action=discussiontoolscompare
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Get information about comment changes between two page revisions.
- fromtitle
First title to compare.
- fromrev
First revision to compare.
- Type: integer
- totitle
Second title to compare.
- torev
Second revision to compare.
- Type: integer
action=discussiontoolsedit
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Post a message on a discussion page.
- paction
Action to perform.
- addcomment
- Add a new comment as a reply to an existing comment.
- addtopic
- Add a new discussion section and the first comment in it.
- This parameter is required.
- One of the following values: addcomment, addtopic
- autosubscribe
Automatically subscribe the user to the talk page thread?
- One of the following values: default, no, yes
- Default: default
- page
The page to perform actions on.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- formtoken
An optional unique ID generated in the client to prevent double-posting.
- Cannot be longer than 16 characters.
- commentname
Name of the comment to reply to. Only used when paction is addcomment.
- commentid
ID of the comment to reply to. Only used when paction is addcomment. Overrides commentname.
- wikitext
Content to post, as wikitext. Cannot be used together with html.
- html
Content to post, as HTML. Cannot be used together with wikitext.
- summary
Edit summary.
- sectiontitle
The title for a new section when using $1section=new. Only used when paction is addtopic.
- allownosectiontitle
Allow posting a new section without a title.
- Type: boolean (details)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- captchaid
Captcha ID (when saving with a captcha response).
- captchaword
Answer to the captcha (when saving with a captcha response).
- nocontent
Omit the HTML content of the new revision in the response.
Change tags to apply to the edit.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- mobileformat
Return parse output in a format suitable for mobile devices.
- Type: boolean (details)
action=discussiontoolsfindcomment
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Find a comment by its ID or name.
- idorname
Comment ID or name
- heading
Heading hash fragment
- page
Page that the heading hash fragment once existed on
action=discussiontoolsgetsubscriptions
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Get the subscription statuses of given topics.
- commentname
Names of the topics to check
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
action=discussiontoolspageinfo
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Returns metadata required to initialize the discussion tools.
- page
The page to perform actions on.
- oldid
The revision number to use (defaults to latest revision).
- Type: integer
- prop
Which properties to get:
- transcludedfrom
- Which other pages comments have been transcluded from
- threaditemshtml
- Representation of the comment threads parsed from the page
- Values (separate with | or alternative): threaditemshtml, transcludedfrom
- Default: transcludedfrom
- threaditemsflags
Flags to alter the output when using prop=threaditemshtml.
- noreplies
- Don't include the full reply tree, just provide the top-level headings (when using prop=threaditemshtml).
- activity
- Include extra activity data about the oldest and latest replies (when using prop=threaditemshtml).
- excludesignatures
- Exclude user signatures from the comments (when using prop=threaditemshtml).
- Values (separate with | or alternative): activity, excludesignatures, noreplies
- excludesignatures
- Deprecated.
Exclude user signatures from the comments (when using prop=threaditemshtml).
action=discussiontoolspreview
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Preview a message on a discussion page.
- type
Type of message to preview
- reply
- Add a new comment as a reply to an existing comment.
- topic
- Add a new discussion section and the first comment in it.
- This parameter is required.
- One of the following values: reply, topic
- page
The page to perform actions on.
- This parameter is required.
- wikitext
Content to preview, as wikitext.
- This parameter is required.
- sectiontitle
The title for a new section when using section=new.
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
- mobileformat
Return parse output in a format suitable for mobile devices.
- Type: boolean (details)
action=discussiontoolssubscribe
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Subscribe (or unsubscribe) to receive notifications about a topic.
- page
A page on which the topic appears
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- commentname
Name of the topic to subscribe to (or unsubscribe from)
- This parameter is required.
- subscribe
True to subscribe, false to unsubscribe
- This parameter is required.
- Type: boolean (details)
action=discussiontoolsthank
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Send a public thank-you notification for a comment.
- page
The page to perform actions on.
- This parameter is required.
- commentid
ID of the comment to thank.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=echocreateevent
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Manually trigger a notification to a user
- user
User to send the notification to
- Type: user, by any of username and user ID (e.g. "#12345")
- header
Header content of the notification
- This parameter is required.
- Cannot be longer than 160 bytes.
- content
Body content of the notification
- This parameter is required.
- Cannot be longer than 5,000 bytes.
- page
Page to link to in the notification
- Type: page title
- Accepts non-existent pages.
- section
Section where notification would be delivered
- This parameter is required.
- One of the following values: alert, notice
- Default: notice
Whether to send an email as well
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send a notification
- api.php?action=echocreateevent&header=Hi&content=From_API [open in sandbox]
action=echomarkread
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Mark notifications as read for the current user.
- wikis
List of wikis to mark notification as read (defaults to only current wiki).
- Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: enwiki
- list
A list of notification IDs to mark as read.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unreadlist
A list of notification IDs to mark as unread.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- all
If set, marks all of a user's notifications as read.
- Type: boolean (details)
- sections
A list of sections to mark as read.
- Values (separate with | or alternative): alert, message
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Mark notification 8 as read
- api.php?action=echomarkread&list=8 [open in sandbox]
- Mark all notifications as read
- api.php?action=echomarkread&all=true [open in sandbox]
- Mark notification 1 as unread
- api.php?action=echomarkread&unreadlist=1 [open in sandbox]
action=echomarkseen
- This module requires read rights.
- Source: Echo
- License: MIT
Mark notifications as seen for the current user.
- type
Type of notifications to mark as seen: 'alert', 'message' or 'all'.
- This parameter is required.
- One of the following values: alert, all, message
- timestampFormat
Timestamp format to use for output, 'ISO_8601' or 'MW'. 'MW' is deprecated here, so all clients should switch to 'ISO_8601'. This parameter will be removed, and 'ISO_8601' will become the only output format.
- One of the following values: ISO_8601, MW
- Default: MW
- Mark notifications of all types as seen
- api.php?action=echomarkseen&type=all [open in sandbox]
action=echomute
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Mute or unmute notifications from certain users or pages.
- type
Which mute list to add to or remove from
- This parameter is required.
- One of the following values: page-linked-title, user
- mute
Pages or users to add to the mute list
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unmute
Pages or users to remove from the mute list
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=echopushsubscriptions
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Manage push subscriptions for the current user.
- command
Action to perform.
- This parameter is required.
- One of the following values: create, delete
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
command=create
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Register push subscriptions for the current user.
- provider
The push service provider for which to register a token.
- This parameter is required.
- One of the following values: apns, fcm
- providertoken
The token to register.
- This parameter is required.
- topic
The APNS topic (app bundle ID) to send the notification to.
- Register a push subscription for the current user.
- api.php?action=echopushsubscriptions&command=create&provider=fcm&providertoken=ABC123 [open in sandbox]
command=delete
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Unregister push subscriptions for the current user or another specified user.
- providertoken
The token associated with the push subscription to unregister.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Unregister a push subscription for the current user.
- api.php?action=echopushsubscriptions&command=delete&providertoken=ABC123 [open in sandbox]
action=edit
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Create and edit pages.
- title
Title of the page to edit. Cannot be used together with pageid.
- pageid
Page ID of the page to edit. Cannot be used together with title.
- Type: integer
- section
Section identifier. 0 for the top section, new for a new section. Often a positive integer, but can also be non-numeric.
- sectiontitle
The title for a new section when using section=new.
- text
Page content.
- summary
Edit summary.
When this parameter is not provided or empty, an edit summary may be generated automatically.
When using section=new and sectiontitle is not provided, the value of this parameter is used for the section title instead, and an edit summary is generated automatically.
Change tags to apply to the revision.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- minor
Mark this edit as a minor edit.
- Type: boolean (details)
- notminor
Do not mark this edit as a minor edit even if the "Mark all edits minor by default" user preference is set.
- Type: boolean (details)
- bot
Mark this edit as a bot edit.
- Type: boolean (details)
- baserevid
ID of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions. Self-conflicts cause the edit to fail unless basetimestamp is set.
- Type: integer
- basetimestamp
Timestamp of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions&rvprop=timestamp. Self-conflicts are ignored.
- Type: timestamp (allowed formats)
- starttimestamp
Timestamp when the editing process began, used to detect edit conflicts. An appropriate value may be obtained using curtimestamp when beginning the edit process (e.g. when loading the page content to edit).
- Type: timestamp (allowed formats)
- recreate
Override any errors about the page having been deleted in the meantime.
- Type: boolean (details)
- createonly
Don't edit the page if it already exists.
- Type: boolean (details)
- nocreate
Throw an error if the page doesn't exist.
- Type: boolean (details)
- watch
- Deprecated.
Add the page to the current user's watchlist.
- Type: boolean (details)
- unwatch
- Deprecated.
Remove the page from the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- md5
The MD5 hash of the text parameter, or the prependtext and appendtext parameters concatenated. If set, the edit won't be done unless the hash is correct.
- prependtext
Add this text to the beginning of the page or section. Overrides text.
- appendtext
Add this text to the end of the page or section. Overrides text.
Use section=new to append a new section, rather than this parameter.
- undo
Undo this revision. Overrides text, prependtext and appendtext.
- Type: integer
- The value must be no less than 0.
- undoafter
Undo all revisions from undo to this one. If not set, just undo one revision.
- Type: integer
- The value must be no less than 0.
- redirect
Automatically resolve redirects.
- Type: boolean (details)
- contentformat
Content serialization format used for the input text.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- contentmodel
Content model of the new content.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- token
A "csrf" token retrieved from action=query&meta=tokens
The token should always be sent as the last parameter, or at least after the text parameter.
- This parameter is required.
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- captchaword
Answer to the CAPTCHA
- captchaid
CAPTCHA ID from previous request
- editorinterface
Name of the editor interface used (such as MobileFrontend-SourceEditor)
- discussiontoolsautosubscribe
Automatically subscribe the user to any new talk page threads created by the edit. Use 'yes' or 'no' to override a user's preference (the default).
- One of the following values: no, preferences, yes
- Default: preferences
- Edit a page.
- api.php?action=edit&title=Test&summary=test%20summary&text=article%20content&baserevid=1234567&token=123ABC [open in sandbox]
- Prepend __NOTOC__ to a page.
- api.php?action=edit&title=Test&summary=NOTOC&minor=&prependtext=__NOTOC__%0A&basetimestamp=2007-08-24T12:34:54Z&token=123ABC [open in sandbox]
- Undo revisions 13579 through 13585 with autosummary.
- api.php?action=edit&title=Test&undo=13585&undoafter=13579&basetimestamp=2007-08-24T12:34:54Z&token=123ABC [open in sandbox]
action=editcheckreferenceurl
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: VisualEditor
- License: MIT
Check the status of a URL for use as a reference.
- url
URL to check.
- This parameter is required.
action=editmassmessagelist
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MassMessage
- License: GPL-2.0-or-later
Edit a mass message delivery list.
- spamlist
Title of the delivery list to update.
- This parameter is required.
- description
New description for the delivery list.
- add
Titles to add to the list.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- remove
Titles to remove from the list.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- minor
Whether the edit should be marked as minor in the history of the list.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Add User talk:Foo and Talk:Bar to the delivery list Example and remove Talk:Baz from it
- api.php?action=editmassmessagelist&spamlist=Example&add=User%20talk%3AFoo%7CTalk%3ABar&remove=Talk%3ABaz&token=TOKEN [open in sandbox]
- Set the description of the delivery list Example to be "FooBar delivery services"
- api.php?action=editmassmessagelist&spamlist=Example&description=FooBor%20delivery%20services&token=TOKEN [open in sandbox]
action=emailuser
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Email a user.
- target
User to send the email to.
- This parameter is required.
- subject
Subject header.
- This parameter is required.
- text
Email body.
- This parameter is required.
- ccme
Send a copy of this mail to me.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send an email to the user WikiSysop with the text Content.
- api.php?action=emailuser&target=WikiSysop&text=Content&token=123ABC [open in sandbox]
action=expandtemplates
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Expands all templates within wikitext.
- title
Title of the page.
- text
Wikitext to convert.
- This parameter is required.
- revid
Revision ID, for
{{REVISIONID}}and similar variables.- Type: integer
- prop
Which pieces of information to get.
Note that if no values are selected, the result will contain the wikitext, but the output will be in a deprecated format.
- wikitext
- The expanded wikitext.
- categories
- Any categories present in the input that are not represented in the wikitext output.
- properties
- Page properties defined by expanded magic words in the wikitext.
- volatile
- Whether the output is volatile and should not be reused elsewhere within the page.
- ttl
- The maximum time after which caches of the result should be invalidated.
- modules
- Any ResourceLoader modules that parser functions have requested be added to the output. Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
- jsconfigvars
- Gives the JavaScript configuration variables specific to the page.
- encodedjsconfigvars
- Gives the JavaScript configuration variables specific to the page as a JSON string.
- parsetree
- The XML parse tree of the input.
- Values (separate with | or alternative): categories, encodedjsconfigvars, jsconfigvars, modules, parsetree, properties, ttl, volatile, wikitext
- includecomments
Whether to include HTML comments in the output.
- Type: boolean (details)
- showstrategykeys
Whether to include internal merge strategy information in jsconfigvars.
- Type: boolean (details)
- generatexml
- Deprecated.
Generate XML parse tree (replaced by prop=parsetree).
- Type: boolean (details)
- templatesandboxprefix
Template sandbox prefix, as with Special:TemplateSandbox.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- templatesandboxtitle
Parse the page using templatesandboxtext in place of the contents of the page named here.
- templatesandboxtext
Parse the page using this page content in place of the page named by templatesandboxtitle.
- templatesandboxcontentmodel
Content model of templatesandboxtext.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- templatesandboxcontentformat
Content format of templatesandboxtext.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- Expand the wikitext {{Project:Sandbox}}.
- api.php?action=expandtemplates&text={{Project:Sandbox}} [open in sandbox]
action=fancycaptchareload
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: ConfirmEdit
- License: GPL-2.0-or-later
Get a new FancyCaptcha.
- Get a new FancyCaptcha
- api.php?action=fancycaptchareload [open in sandbox]
action=featuredfeed
- This module requires read rights.
- Source: FeaturedFeeds
- License: WTFPL
Returns a featured content feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- feed
Feed name.
- This parameter is required.
- One of the following values: featured, onthisday, potd
- language
Feed language code. Ignored by some feeds.
- Retrieve feed "potd"
- api.php?action=featuredfeed&feed=potd [open in sandbox]
action=feedcontributions
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a user's contributions feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- user
What users to get the contributions for.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user, IP range, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- namespace
Which namespace to filter the contributions by.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- year
From year (and earlier).
- Type: integer
- month
From month (and earlier).
- Type: integer
- tagfilter
Filter contributions that have these tags.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Citing predatory open access journal, Contest or editathon, Deputy, End of page text, External Link added to disambiguation page, Extraneous formatting, HotCat, JWB, Newcomer task, New user adding protection template, OAuth CID: 21, OAuth CID: 60, OAuth CID: 64, OAuth CID: 67, OAuth CID: 76, OAuth CID: 85, OAuth CID: 99, OAuth CID: 115, OAuth CID: 142, OAuth CID: 144, OAuth CID: 150, OAuth CID: 151, OAuth CID: 154, OAuth CID: 159, OAuth CID: 194, OAuth CID: 206, OAuth CID: 211, OAuth CID: 212, OAuth CID: 218, OAuth CID: 236, OAuth CID: 239, OAuth CID: 251, OAuth CID: 252, OAuth CID: 259, OAuth CID: 261, OAuth CID: 263, OAuth CID: 274, OAuth CID: 278, OAuth CID: 285, OAuth CID: 297, OAuth CID: 306, OAuth CID: 314, OAuth CID: 320, OAuth CID: 376, OAuth CID: 410, OAuth CID: 429, OAuth CID: 473, OAuth CID: 540, OAuth CID: 542, OAuth CID: 543, OAuth CID: 563, OAuth CID: 593, OAuth CID: 612, OAuth CID: 628, OAuth CID: 651, OAuth CID: 670, OAuth CID: 678, OAuth CID: 679, OAuth CID: 817, OAuth CID: 860, OAuth CID: 861, OAuth CID: 874, OAuth CID: 951, OAuth CID: 1003, OAuth CID: 1013, OAuth CID: 1015, OAuth CID: 1024, OAuth CID: 1188, OAuth CID: 1224, OAuth CID: 1232, OAuth CID: 1261, OAuth CID: 1277, OAuth CID: 1352, OAuth CID: 1359, OAuth CID: 1365, OAuth CID: 1389, OAuth CID: 1413, OAuth CID: 1436, OAuth CID: 1452, OAuth CID: 1503, OAuth CID: 1566, OAuth CID: 1703, OAuth CID: 1745, OAuth CID: 1779, OAuth CID: 1784, OAuth CID: 1804, OAuth CID: 1805, OAuth CID: 1809, OAuth CID: 1841, OAuth CID: 1887, OAuth CID: 1904, OAuth CID: 2008, OAuth CID: 2179, OAuth CID: 2395, OAuth CID: 2786, OAuth CID: 2922, OAuth CID: 3113, OAuth CID: 3201, OAuth CID: 3251, OAuth CID: 3711, OAuth CID: 4476, OAuth CID: 4664, OAuth CID: 4978, OAuth CID: 5481, OAuth CID: 5765, OAuth CID: 6365, OAuth CID: 6544, OAuth CID: 6640, OAuth CID: 6969, OAuth CID: 8393, OAuth CID: 9394, OAuth CID: 9792, OAuth CID: 10649, OAuth CID: 13185, OAuth CID: 13506, OAuth CID: 13933, OAuth CID: 14358, OAuth CID: 14740, OAuth CID: 14811, OAuth CID: 16301, OAuth CID: 16534, OAuth CID: 16734, OAuth CID: 16794, OAuth CID: 17034, OAuth CID: 17091, OAuth CID: 17154, OAuth CID: 17361, OAuth CID: 17546, OAuth CID: 17716, OAuth CID: 17725, OAuth CID: 17726, OAuth CID: 17755, OAuth CID: 17941, Possible disruption, Possible self promotion in user or draftspace, Possible self promotion in userspace, ProveIt edit, Rapid reverts, RedWarn, RfC, Section blanking, Ultraviolet, WPCleaner, WikiLeaks, WikiLoop Battlefield, WikiShield script, XFDC, abusefilter-condition-limit, advanced mobile edit, android app edit, app-ai-assist, app-description-add, app-description-change, app-description-translate, app-full-source, app-image-add-infobox, app-image-add-top, app-image-caption-add, app-image-caption-translate, app-image-tag-add, app-rollback, app-section-source, app-select-source, app-suggestededit, app-talk-reply, app-talk-source, app-talk-topic, app-undo, autobiography, bad external, blanking, bot trial, campaign-external-machine-translation, canned edit summary, categories removed, centralnotice, centralnotice translation, changing height or weight, changing time or duration, coi-spam, community configuration, congressedits, contentious topics alert, contenttranslation, contenttranslation-high-unmodified-mt-text, contenttranslation-needcheck, contenttranslation-v2, convenient-discussions, de-userfying, deprecated source, disambiguation template removed, disambiguator-link-added, discussiontools, discussiontools-added-comment, discussiontools-edit, discussiontools-newtopic, discussiontools-reply, discussiontools-source, discussiontools-source-enhanced, discussiontools-visual, draft-userpage-link, editProtectedHelper, editcheck-newcontent, editcheck-newreference, editcheck-paste-shown, editcheck-reference-decline-common-knowledge, editcheck-reference-decline-irrelevant, editcheck-reference-decline-other, editcheck-reference-decline-uncertain, editcheck-references, editcheck-references-activated, editcheck-references-shown, editcheck-tone, editcheck-tone-shown, editsuggestion-seen, editsuggestion-used, excessive whitespace, extraneous markup, fa-ga-change, fileimporter-remote, fixed lint errors, harv-error, help module question, help panel question, huggle, image template removal, invalid-timedtext-edit, ios app edit, large non-free file, large plot addition, large unwikified new article, massmessage-delivery, massmove, mentor list change, mentorship module question, mentorship panel question, missing file added, mobile app edit, mobile edit, mobile web edit, moveToDraft, mw-blank, mw-changed-redirect-target, mw-contentmodelchange, mw-edited-other-users-css, mw-edited-other-users-js, mw-ipblock-appeal, mw-manual-revert, mw-new-redirect, mw-recreated, mw-removed-redirect, mw-replace, mw-reverted, mw-rollback, mw-server-side-upload, mw-undo, newcomer task, newcomer task add link, newcomer task copyedit, newcomer task expand, newcomer task image suggestion, newcomer task links, newcomer task references, newcomer task revise tone, newcomer task section image suggestion, newcomer task update, new user modifying archives, new user moving page out of userspace, non-English content, nowiki added, nuke, ooze, pageswap, pagetriage, parliamentedit, parsermigration-visual-bug, possible AI-generated citations, possible BLPCRIME issue, possible MOS:ETHNICITY violation, possible birth or death date change, possible cut and paste move, possible formatting issues, possible libel or vandalism, possible link spam, possible prose issues, possible unexplained content removal, possible unreferenced addition to BLP, possible vandalism, possibly inaccurate edit summary, pronoun-change, rapid date format changes, reference list removal, references removed, removal of COI template, removal of Category:Living People, removal of copyvio templates, removal of speedy deletion templates, removing declined unblock request, reverting anti-vandal bot, sectiontranslation, self-published-blog, self-published source, self-renaming and bad user talk moves, shortdesc helper, shouting, talk banner shell conversion, talk page blanking, twinkle, unsourced AFC submission, unusual redirect, userspace spam, very short new article, visualeditor, visualeditor-needcheck, visualeditor-switched, visualeditor-wikitext, wikieditor, wikilinks removed, wikilove
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: (empty)
- deletedonly
Show only deleted contributions.
- Type: boolean (details)
- toponly
Only show edits that are the latest revisions.
- Type: boolean (details)
- newonly
Only show edits that are page creations.
- Type: boolean (details)
- hideminor
Hide minor edits.
- Type: boolean (details)
- showsizediff
Disabled due to miser mode.
- Type: boolean (details)
- Return contributions for user Example.
- api.php?action=feedcontributions&user=Example [open in sandbox]
action=feedrecentchanges
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a recent changes feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- namespace
Namespace to limit the results to.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- invert
All namespaces but the selected one.
- Type: boolean (details)
- associated
Include associated (talk or main) namespace.
- Type: boolean (details)
- days
Days to limit the results to.
- Type: integer
- The value must be no less than 1.
- Default: 7
- limit
Maximum number of results to return.
- Type: integer
- The value must be between 1 and 50.
- Default: 50
- from
Show changes since then.
- Type: timestamp (allowed formats)
- hideminor
Hide minor changes.
- Type: boolean (details)
- hidebots
Hide changes made by bots.
- Type: boolean (details)
- hideanons
Hide changes made by anonymous users and temporary accounts.
- Type: boolean (details)
- hideliu
Hide changes made by registered users.
- Type: boolean (details)
- hidepatrolled
Hide patrolled changes.
- Type: boolean (details)
- hidemyself
Hide changes made by the current user.
- Type: boolean (details)
- hidecategorization
Hide category membership changes.
- Type: boolean (details)
- tagfilter
Filter by tag.
All edits except ones tagged with the selected ones.
- Type: boolean (details)
- target
Show only changes on pages linked from this page.
- showlinkedto
Show changes on pages linked to the selected page instead.
- Type: boolean (details)
- Show recent changes.
- api.php?action=feedrecentchanges [open in sandbox]
- Show recent changes for 30 days.
- api.php?action=feedrecentchanges&days=30 [open in sandbox]
action=feedwatchlist
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a watchlist feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- hours
List pages modified within this many hours from now.
- Type: integer
- The value must be between 1 and 72.
- Default: 24
- linktosections
Link directly to changed sections if possible.
- Type: boolean (details)
- allrev
Include multiple revisions of the same page within given timeframe.
- Type: boolean (details)
- wlowner
Used along with token to access a different user's watchlist.
- Type: user, by username
- wltoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wlshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set show=minor|!anon.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
- wltype
Which types of changes to show:
- edit
- Regular page edits.
- new
- Page creations.
- log
- Log entries.
- external
- External changes.
- categorize
- Category membership changes.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- wlexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- Show the watchlist feed.
- api.php?action=feedwatchlist [open in sandbox]
- Show all changes to watched pages in the past 6 hours.
- api.php?action=feedwatchlist&allrev=&hours=6 [open in sandbox]
action=filerevert
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Revert a file to an old version.
- filename
Target filename, without the File: prefix.
- This parameter is required.
- comment
Upload comment.
- Default: (empty)
- archivename
Archive name of the revision to revert to.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Revert Wiki.png to the version of 2011-03-05T15:27:40Z.
- api.php?action=filerevert&filename=Wiki.png&comment=Revert&archivename=20110305152740!Wiki.png&token=123ABC [open in sandbox]
action=flagconfig
- This module requires read rights.
- Source: FlaggedRevs (Pending Changes)
- License: GPL-2.0-or-later
Get basic information about review flag configuration for this site.
The following parameters are returned for each tag:
- name
- The key name of this tag.
- levels
- Number of levels the tag has (above "not tagged").
Flagged revisions have an assigned level for each tag. The highest tier that all the tags meet is the review tier of the entire revision.
- Fetch flag configuration
- api.php?action=flagconfig [open in sandbox]
action=globalblock
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GlobalBlocking
- License: GPL-2.0-or-later
Globally block or unblock a user.
- id
ID of the global block to modify or unblock (obtained through list=globalblocks). Cannot be used together with target.
- Type: integer
- target
The target IP address or username. Cannot be used together with id.
- Type: user, by any of username, IP, Temporary user and IP range
- expiry
If specified, will block or reblock the user. Determines how long the block will last for, e.g. "5 months" or "2 weeks". If set to "infinite" or "indefinite" the block will never expire.
- Type: expiry (details)
- unblock
If specified, will unblock the user.
- Type: boolean (details)
- reason
The reason for blocking/unblocking.
- This parameter is required.
- anononly
Specify this if the block should only affect logged-out users globally.
- Type: boolean (details)
- allow-account-creation
Specify this if the global block should not prevent account creation.
- Type: boolean (details)
- enable-autoblock
Specify this if the global block should trigger global autoblocks.
- Type: boolean (details)
- block-email
Specify this if the global block should prevent the user from sending email.
- Type: boolean (details)
- modify
Specify this if the existing block on the target should be modified
- Type: boolean (details)
- alsolocal
Block the user locally as well. Cannot be used together with id.
- Type: boolean (details)
- localblockstalk
Revoke talk page access locally. Cannot be used together with id.
- Type: boolean (details)
- localblocksemail
Revoke email access locally. Cannot be used together with id.
- Type: boolean (details)
- localanononly
Specify this if the block should only affect logged-out users locally. Cannot be used together with id.
- Type: boolean (details)
- local-allow-account-creation
Specify this if the local block should not prevent account creation. Cannot be used together with id.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Block 192.0.2.1 indefinitely with reason "Cross-wiki abuse"
- api.php?action=globalblock&target=192.0.2.1&expiry=indefinite&reason=Cross-wiki%20abuse&token=123ABC [open in sandbox]
action=globalpreferenceoverrides
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GlobalPreferences
- License: GPL-2.0-or-later
Change local overrides for global preferences for the current user.
Global values for affected preferences will be ignored.
- reset
Reset local overrides. Removes all, or, depending on the value of the
resetkindsparameter, some types of local overrides and makes them global again.- Type: boolean (details)
- resetkinds
List of types of overrides to reset when the reset option is set.
- Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
- Default: all
- change
List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., preferencename|otherpreference|..., the override will be removed. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- optionname
The name of the override that should be set to the value given by optionvalue.
- optionvalue
The value for the override specified by optionname.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Remove all local overrides.
- api.php?action=globalpreferenceoverrides&reset=&token=123ABC [open in sandbox]
- Set or change overrides for skin and hideminor preferences.
- api.php?action=globalpreferenceoverrides&change=skin=vector|hideminor=1&token=123ABC [open in sandbox]
action=globalpreferences
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GlobalPreferences
- License: GPL-2.0-or-later
Change global preferences of the current user.
Only preferences registered for the current wiki can be changed locally.
- reset
Reset global preferences. Removes all, or, depending on the value of the
resetkindsparameter, some types of global preferences and make them not global anymore.- Type: boolean (details)
- resetkinds
List of types of preferences to reset when the reset option is set.
- Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
- Default: all
- change
List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., preferencename|otherpreference|..., the preference will be made non-global. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- optionname
The name of the preference that should be set to the value given by optionvalue.
- optionvalue
The value for the preference specified by optionname.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Make a single preference non-global.
- api.php?action=globalpreferences&change=skin=&token=123ABC [open in sandbox]
- Make all preferences non-global.
- api.php?action=globalpreferences&reset=&token=123ABC [open in sandbox]
- Change skin and hideminor preferences.
- api.php?action=globalpreferences&change=skin=vector|hideminor=1&token=123ABC [open in sandbox]
action=globaluserrights
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CentralAuth
- License: GPL-2.0-or-later
Add/remove a user to/from global groups.
- user
Global username.
- Type: user, by any of username and user ID (e.g. "#12345")
- userid
- Deprecated.
Global user ID.
- Type: integer
- add
Add the user to these global groups.
- Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
- expiry
Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: infinite
- remove
Remove the user from these global groups.
- Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
- reason
Reason for the change.
- Default: (empty)
- token
A "userrights" token retrieved from action=query&meta=tokens
For compatibility, the token used in the web UI is also accepted.
- This parameter is required.
This parameter is currently unused.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- Add user FooBot to global group "bot", and remove from global groups "sysop" and "bureaucrat"
- api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
- Add the global user with ID 123 to global group "bot", and remove from global groups "sysop" and "bureaucrat"
- api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
action=growthinvalidateimagerecommendation
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Invalidate an image recommendation.
Calling this API will:
- Reset the "hasrecommendation:image" weighted tag for the article, so the article is no longer returned in search results for image suggestions.
- Add the article to a short-lived cache, which the GrowthExperiments extension's ImageRecommendationFilter consults to decide if the article should be excluded from the user's suggested edits queue when accessed on Special:Homepage or via the action=query&list=growthtasks API.
- Generate and send an event to EventGate to the image-suggestion-feedback stream. This allows improvements in the image suggestion pipeline, as the code in the pipeline can account for user feedback when generating recommendations.
Further reading: mediawiki.org
- tasktype
Task type (top-level or section-level)
- One of the following values: image-recommendation, section-image-recommendation
- Default: image-recommendation
- title
Title of the article the image recommendation task is for
- This parameter is required.
- Type: page title
- Accepts non-existent pages.
- filename
The unprefixed filename for the image recommendation, e.g. Foo.jpg
- This parameter is required.
- sectiontitle
The title of the section the image recommendation is for, e.g. History
- sectionnumber
The 1-based index of the section the image recommendation is for, e.g. 3
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthinvalidatepersonalizedpraisesuggestion
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
- mentee
Mentee to invalidate
- This parameter is required.
- Type: user, by any of username and user ID (e.g. "#12345")
- reason
Reason to invalidate the suggestion
- One of the following values: praised, skipped
- skipreason
Skip reason to invalidate the suggestion
- One of the following values: already-praised, not-now, not-praiseworthy, other
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthinvalidaterevisetonerecommendation
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Drop a 'Revise Tone' recommendation for a given page.
- title
Title of the page for which to drop the recommendation, without namespace.
- This parameter is required.
- Type: page title
- Only accepts pages that exist.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthmanagementorlist
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
- geaction
Action
- This parameter is required.
- One of the following values: add, change, remove
- message
Introduction message (use an empty string for the default mentor message)
- weight
Weight
- One of the following values: 0, 1, 2, 4
- isaway
Is the mentor currently away? Has to be set (defaults to false).
- Type: boolean (details)
- awaytimestamp
Until when is the mentor away? Maximum is 1 year from today. Ignored unless isaway is true.
- Type: timestamp (allowed formats)
- summary
Reason for the change
- Default: (empty)
- username
Username of the mentor affected by the change. If not provided, currently logged in user will be used. Can be only used by privileged users.
- Type: user, by username
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthmentordashboardupdatedata
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthsetmenteestatus
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
- state
New status of the mentee (warning: setting this to optout will permanently deletes mentee/mentor relationship)
- enabled
- Mentorship module is enabled
- disabled
- Mentorship module is fully disabled. This is normally set by the software and used for A/B testing.
- optout
- Mentee opted out from mentorship; mentee/mentor relationship will be deleted, mentorship module will be replaced with a possibility to opt back in
- This parameter is required.
- One of the following values: disabled, enabled, optout
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthsetmentor
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Set user's mentor. Change will be publicly logged.
- mentee
Mentee's username
- This parameter is required.
- Type: user, by username
- mentor
Mentor's username
- This parameter is required.
- Type: user, by username
- reason
Reason for the change
- Default: (empty)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=growthstarmentee
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Mark or unmark a mentee as starred by current user (stored privately and not logged)
- gesaction
Action to take (star or unstar)
- This parameter is required.
- One of the following values: star, unstar
- gesmentee
Mentee to (un)star
- This parameter is required.
- Type: user, by any of username and user ID (e.g. "#12345")
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=help
- Source: MediaWiki
- License: GPL-2.0-or-later
Display help for the specified modules.
- modules
Modules to display help for (values of the action and format parameters, or main). Can specify submodules with a +.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: main
- submodules
Include help for submodules of the named module.
- Type: boolean (details)
- recursivesubmodules
Include help for submodules recursively.
- Type: boolean (details)
- wrap
Wrap the output in a standard API response structure.
- Type: boolean (details)
- toc
Include a table of contents in the HTML output.
- Type: boolean (details)
- Help for the main module.
- api.php?action=help [open in sandbox]
- Help for action=query and all its submodules.
- api.php?action=help&modules=query&submodules=1 [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
- Help for the help module itself.
- api.php?action=help&modules=help [open in sandbox]
- Help for two query submodules.
- api.php?action=help&modules=query+info|query+categorymembers [open in sandbox]
action=helppanelquestionposter
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Handle questions posted via the help panel for the current user.
- body
The text of the question provided by the user.
- This parameter is required.
- Cannot be longer than 2,000 characters.
- source
The method by which the question was posted.
- helpdesk
- The "Ask the help desk" panel
- mentor-homepage
- The "Ask your mentor" panel on the newcomer homepage
- mentor-helppanel
- The "Ask your mentor" screen on the help panel
- helppanel
- The "Ask the help desk" panel (old name)
- homepage-mentorship
- The "Ask your mentor" panel on the newcomer homepage (old name)
- One of the following values: helpdesk, helppanel, homepage-mentorship, mentor-helppanel, mentor-homepage
- Default: helpdesk
- relevanttitle
The relevant title, if selected, to include with the question.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=homepagequestionstore
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Obtain formatted questions posted via homepage modules
- storage
The storage location of the questions.
- This parameter is required.
- One of the following values: growthexperiments-helppanel-questions, growthexperiments-mentor-questions
action=imagerotate
- Source: MediaWiki
- License: GPL-2.0-or-later
This module has been disabled.
action=import
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Import a page from another wiki, or from an XML file.
Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending a file for the xml parameter.
- summary
Log entry import summary.
- xml
Uploaded XML file.
- Must be posted as a file upload using multipart/form-data.
- interwikiprefix
For uploaded imports: interwiki prefix to apply to unknown usernames (and known users if assignknownusers is set).
- interwikisource
For interwiki imports: wiki to import from.
- One of the following values: commons, de, es, fr, it, meta, nost, outreachwiki, pl, test2wiki
- interwikipage
For interwiki imports: page to import.
- fullhistory
For interwiki imports: import the full history, not just the current version.
- Type: boolean (details)
- templates
For interwiki imports: import all included templates as well.
- Type: boolean (details)
- namespace
Import to this namespace. Cannot be used together with rootpage.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- assignknownusers
Assign edits to local users where the named user exists locally.
- Type: boolean (details)
- rootpage
Import as subpage of this page. Cannot be used together with namespace.
Change tags to apply to the entry in the import log and to the dummy revision on the imported pages.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Import meta:Help:ParserFunctions to namespace 100 with full history.
- api.php?action=import&interwikisource=meta&interwikipage=Help:ParserFunctions&namespace=100&fullhistory=&token=123ABC [open in sandbox]
action=jsonconfig
- This module requires read rights.
- Source: JsonConfig
- License: GPL-2.0-or-later
Allows direct access to JsonConfig subsystem.
- command
Which sub-action to perform on JsonConfig:
- status
- Shows JsonConfig configuration.
- reset
- Clears configurations from cache. Requires title parameter and jsonconfig-flush right.
- reload
- Reloads and caches configurations from config store. Requires title parameter and jsonconfig-reset right.
- One of the following values: reload, reset, status
- Default: status
- namespace
Namespace number of the title to process.
- Type: integer
- title
Title to process without namespace prefix.
- Default: (empty)
- Show configuration
- api.php?action=jsonconfig&format=json [open in sandbox]
- Reset Data:Brazil/Amazonas.map
- api.php?action=jsonconfig&command=reset&namespace=486&title=Brazil/Amazonas.map&format=json [open in sandbox]
- Reload Data:Brazil/Amazonas.map
- api.php?action=jsonconfig&command=reload&namespace=486&title=Brazil/Amazonas.map&format=json [open in sandbox]
action=jsondata
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: JsonConfig
- License: GPL-2.0-or-later
Retrieve localized JSON data.
- title
Title to get. By default assumes namespace to be "Data:"
- This parameter is required.
- Get JSON content of the Sample.tab page, localized to user's language
- api.php?action=jsondata&formatversion=2&format=jsonfm&title=Sample.tab [open in sandbox]
- Get JSON content of the Sample.tab page localized to French
- api.php?action=jsondata&formatversion=2&format=jsonfm&title=Sample.tab&uselang=fr [open in sandbox]
action=jsontransform
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: JsonConfig
- License: GPL-2.0-or-later
Retrieve JSON data transformed by a Lua function.
- title
Title to process without namespace prefix.
- This parameter is required.
- jtmodule
Name of Lua module to load transform code from. Defaults to Module: namespace.
- This parameter is required.
- jtfunction
Name of Lua function to run
- This parameter is required.
- jtargs
Sequence of strings to pass as arguments to the Lua transform function
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get JSON content of the Sample.tab page running through a Lua transform
- api.php?action=jsontransform&formatversion=2&format=jsonfm&title=Sample.tab&jtmodule=Samples&jtfunction=round&jtargs=decimals=2|columns=a,b [open in sandbox]
action=languagesearch
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Search for language names in any script.
- search
Search string.
- This parameter is required.
- typos
Number of spelling mistakes allowed in the search string.
- Type: integer
- Default: 1
- Search for "Te"
- api.php?action=languagesearch&search=Te [open in sandbox]
- Search for "ഫി"
- api.php?action=languagesearch&search=ഫി [open in sandbox]
- Search for "ഫി", allowing one typo
- api.php?action=languagesearch&search=ഫി&typos=1 [open in sandbox]
action=linkaccount (link)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Link an account from a third-party provider to the current user.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=link, and a csrf token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying linkreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with linkcontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to linkreturnurl. Then post to this module with linkcontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- linkrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=link or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- linkmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- linkmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- linkreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or linkcontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a linkcontinue request to this API module.
- linkcontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or linkreturnurl is required.
- Type: boolean (details)
- linktoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=link (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of linking to an account from Example.
- api.php?action=linkaccount&provider=Example&linkreturnurl=http://example.org/&linktoken=123ABC [open in sandbox]
action=login (lg)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log in and get authentication cookies.
This action should only be used in combination with Special:BotPasswords; use for main-account login is deprecated and may fail without warning. To safely log in to the main account, use action=clientlogin.
- lgname
Username.
- lgpassword
Password.
- lgdomain
Domain (optional).
- lgtoken
A "login" token retrieved from action=query&meta=tokens
action=logout
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log out and clear session data.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- checkuserclienthints
Client hints data supplied alongside requests to ApiLogout. For internal use only.
- Log the current user out.
- api.php?action=logout&token=123ABC [open in sandbox]
action=managetags
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform management tasks relating to change tags.
Which operation to perform:
- create
- Create a new change tag for manual use.
- delete
- Remove a change tag from the database, including removing the tag from all revisions, recent change entries and log entries on which it is used.
- activate
- Activate a change tag, allowing users to apply it manually.
- deactivate
- Deactivate a change tag, preventing users from applying it manually.
- This parameter is required.
- One of the following values: activate, create, deactivate, delete
Tag to create, delete, activate or deactivate. For tag creation, the tag must not exist. For tag deletion, the tag must exist. For tag activation, the tag must exist and not be in use by an extension. For tag deactivation, the tag must be currently active and manually defined.
- This parameter is required.
An optional reason for creating, deleting, activating or deactivating the tag.
- Default: (empty)
Whether to ignore any warnings that are issued during the operation.
- Type: boolean (details)
Change tags to apply to the entry in the tag management log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Create a tag named spam with the reason For use in edit patrolling
- api.php?action=managetags&operation=create&tag=spam&reason=For+use+in+edit+patrolling&token=123ABC [open in sandbox]
- Delete the vandlaism tag with the reason Misspelt
- api.php?action=managetags&operation=delete&tag=vandlaism&reason=Misspelt&token=123ABC [open in sandbox]
- Activate a tag named spam with the reason For use in edit patrolling
- api.php?action=managetags&operation=activate&tag=spam&reason=For+use+in+edit+patrolling&token=123ABC [open in sandbox]
- Deactivate a tag named spam with the reason No longer required
- api.php?action=managetags&operation=deactivate&tag=spam&reason=No+longer+required&token=123ABC [open in sandbox]
action=massmessage
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MassMessage
- License: GPL-2.0-or-later
Send a message to a list of pages.
- spamlist
Page containing list of pages to leave a message on.
- This parameter is required.
- subject
Subject line of the message.
- This parameter is required.
- message
Message body text.
- page-message
Page to be sent along with the message body.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send a message to the list at Signpost Spamlist with the subject "New Signpost", and message body of "Please read it".
- api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&message=Please%20read%20it&token=TOKEN [open in sandbox]
- Send a message to the list at Signpost Spamlist with the subject "New Signpost", and the message as the content of the page "Help Page".
- api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&page-message=Help_Page&token=TOKEN [open in sandbox]
- Send a message to the list at Signpost Spamlist with the subject "New Signpost", and message body of "Please read it" appended with the content from page "Help Page".
- api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&message=Please%20read%20it&page-message=Help_Page&token=TOKEN [open in sandbox]
action=mergehistory
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Merge page histories.
- from
Title of the page from which history will be merged. Cannot be used together with fromid.
- fromid
Page ID of the page from which history will be merged. Cannot be used together with from.
- Type: integer
- to
Title of the page to which history will be merged. Cannot be used together with toid.
- toid
Page ID of the page to which history will be merged. Cannot be used together with to.
- Type: integer
- timestamp
Timestamp up to which revisions will be moved from the source page's history to the destination page's history. If omitted, the entire page history of the source page will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.
- reason
Reason for the history merge.
- Default: (empty)
- starttimestamp
Timestamp from which revisions will be moved from the source page's history to the destination page's history. If omitted, all revisions before the timestamp parameter (or the entire history if neither are specified) will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Merge the entire history of Oldpage into Newpage.
- api.php?action=mergehistory&from=Oldpage&to=Newpage&token=123ABC&reason=Reason [open in sandbox]
- Merge the page revisions of Oldpage dating up to 2015-12-31T04:37:41Z into Newpage.
- api.php?action=mergehistory&from=Oldpage&to=Newpage&token=123ABC&reason=Reason×tamp=2015-12-31T04%3A37%3A41Z [open in sandbox]
action=move
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Move a page.
- from
Title of the page to rename. Cannot be used together with fromid.
- fromid
Page ID of the page to rename. Cannot be used together with from.
- Type: integer
- to
Title to rename the page to.
- This parameter is required.
- reason
Reason for the rename.
- Default: (empty)
- movetalk
Rename the talk page, if it exists.
- Type: boolean (details)
- movesubpages
Rename subpages, if applicable.
- Type: boolean (details)
- noredirect
Don't create a redirect.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- ignorewarnings
Ignore any warnings.
- Type: boolean (details)
Change tags to apply to the entry in the move log and to the dummy revision on the destination page.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Move Badtitle to Goodtitle without leaving a redirect.
- api.php?action=move&from=Badtitle&to=Goodtitle&token=123ABC&reason=Misspelled%20title&movetalk=&noredirect= [open in sandbox]
action=opensearch
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Search the wiki using the OpenSearch protocol.
- search
Search string.
- This parameter is required.
- namespace
Namespaces to search. Ignored if search begins with a valid namespace prefix.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: 0
- limit
Maximum number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- profile
Search profile to use.
- strict
- Strict profile with few punctuation characters removed but diacritics and stress marks are kept.
- normal
- Few punctuation characters, some diacritics and stopwords removed.
- fuzzy
- Similar to normal with typo correction (two typos supported).
- fast-fuzzy
- Experimental fuzzy profile (may be removed at any time)
- classic
- Classic prefix, few punctuation characters and some diacritics removed.
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: classic, engine_autoselect, fast-fuzzy, fuzzy, normal, strict
- Default: engine_autoselect
- suggest
- Deprecated.
No longer used.
- Type: boolean (details)
- redirects
How to handle redirects:
- return
- Return the redirect itself.
- resolve
- Return the target page. May return fewer than limit results.
For historical reasons, the default is "return" for format=json and "resolve" for other formats.
- One of the following values: resolve, return
- format
The format of the output.
- One of the following values: json, jsonfm, xml, xmlfm
- Default: json
- warningsaserror
If warnings are raised with format=json, return an API error instead of ignoring them.
- Type: boolean (details)
- Find pages beginning with Te.
- api.php?action=opensearch&search=Te [open in sandbox]
action=options
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change preferences of the current user.
Only options which are registered in core or in one of installed extensions, or options with keys prefixed with userjs- (intended to be used by user scripts), can be set.
- reset
Resets preferences to the site defaults.
- Type: boolean (details)
- resetkinds
List of types of options to reset when the reset option is set.
- Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
- Default: all
- change
List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., optionname|otheroption|..., the option will be reset to its default value. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- optionname
The name of the option that should be set to the value given by optionvalue.
- optionvalue
The value for the option specified by optionname. When optionname is set but optionvalue is omitted, the option will be reset to its default value.
- global
What to do if the option was set globally using the GlobalPreferences extension.
- ignore: Do nothing. The option remains with its previous value.
- override: Add a local override.
- update: Update the option globally.
- create: Set the option globally, overriding any local value.
- One of the following values: create, ignore, override, update
- Default: ignore
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Reset all preferences.
- api.php?action=options&reset=&token=123ABC [open in sandbox]
- Change skin and hideminor preferences.
- api.php?action=options&change=skin=vector|hideminor=1&token=123ABC [open in sandbox]
- Reset all preferences, then set skin and nickname.
- api.php?action=options&reset=&change=skin=monobook&optionname=nickname&optionvalue=[[User:Beau|Beau]]%20([[User_talk:Beau|talk]])&token=123ABC [open in sandbox]
action=pagetriageaction
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: PageTriage
- License: MIT
Mark an article as reviewed or unreviewed.
- pageid
ID for the page that the action is performed on.
- This parameter is required.
- Type: integer
- reviewed
Whether the page should be marked as reviewed
- One of the following values: 0, 1
- enqueue
Whether the page should be added to PageTriage queue.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- note
Personal note to page creators from reviewers.
- skipnotif
Whether to skip notification.
- Type: boolean (details)
Change tags to apply to the log entries generated for this action.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
action=pagetriagelist
- This module requires read rights.
- Source: PageTriage
- License: MIT
Get a list of page IDs for building a PageTriage queue.
- show_predicted_class_stub
Whether to include predicted class stub
- Type: boolean (details)
- show_predicted_class_start
Whether to include predicted class start
- Type: boolean (details)
- show_predicted_class_c
Whether to include predicted class C
- Type: boolean (details)
- show_predicted_class_b
Whether to include predicted class B
- Type: boolean (details)
- show_predicted_class_good
Whether to include predicted class good
- Type: boolean (details)
- show_predicted_class_featured
Whether to included predicted class featured
- Type: boolean (details)
- show_predicted_issues_vandalism
Whether to include potential issues of vandalism
- Type: boolean (details)
- show_predicted_issues_spam
Whether to include potential issues of spam
- Type: boolean (details)
- show_predicted_issues_attack
Whether to include potential issues of attack
- Type: boolean (details)
- show_predicted_issues_none
Whether to include no potential issues
- Type: boolean (details)
- show_predicted_issues_copyvio
Whether to include potential issues of copyvio
- Type: boolean (details)
- showbots
Whether to show only bot edits.
- Type: boolean (details)
- showautopatrolled
Whether to show only edits by users with the autopatrol user right.
- Type: boolean (details)
- showredirs
Whether to include redirects.
- Type: boolean (details)
- showothers
Whether to include pages that are not redirects nor nominated for deletion.
- Type: boolean (details)
- showreviewed
Whether to include reviewed.
- Type: boolean (details)
- showunreviewed
Whether to include unreviewed.
- Type: boolean (details)
- showdeleted
Whether to include "proposed for deletion".
- Type: boolean (details)
- namespace
What namespace to pull pages from.
- Type: integer
- afc_state
Which Articles-for-Creation state to show.
- Type: integer
- no_category
Whether to show only pages with no category.
- Type: boolean (details)
- unreferenced
Whether to show only pages without any references.
- Type: boolean (details)
- no_inbound_links
Whether to show only pages with no inbound links.
- Type: boolean (details)
- recreated
Whether to show only pages that were previously deleted.
- Type: boolean (details)
- non_autoconfirmed_users
Whether to show only pages created by non autoconfirmed users.
- Type: boolean (details)
- learners
Whether to show only pages created by newly autoconfirmed users.
- Type: boolean (details)
- blocked_users
Whether to show only pages created by blocked users.
- Type: boolean (details)
- username
Show only pages created by username.
- Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
- keyword
Show only pages with this keyword in the snippet.
- date_range_from
Show only pages created on this date and after.
- Type: timestamp (allowed formats)
- date_range_to
Show only pages created on this date and before.
- Type: timestamp (allowed formats)
- page_id
Return data for the specified page IDs, ignoring other parameters.
- Type: integer
- limit
The maximum number of results to return.
- Type: integer
- The value must be between 1 and 200.
- Default: 20
- offset
Timestamp to start from.
- Type: integer
- pageoffset
Page ID to start from (requires offset param to be passed as well).
- Type: integer
- dir
The direction the list should be sorted in - oldestfirst, newestfirst, oldestreview or newestreview.
- One of the following values: newestfirst, newestreview, oldestfirst, oldestreview
- List 100 unreviewed pages in namespace 0
- api.php?action=pagetriagelist&limit=100&namespace=0&showunreviewed=1 [open in sandbox]
action=pagetriagestats
- This module requires read rights.
- Source: PageTriage
- License: MIT
Get the stats for page triage.
- show_predicted_class_stub
Whether to include predicted class stub
- Type: boolean (details)
- show_predicted_class_start
Whether to include predicted class start
- Type: boolean (details)
- show_predicted_class_c
Whether to include predicted class C
- Type: boolean (details)
- show_predicted_class_b
Whether to include predicted class B
- Type: boolean (details)
- show_predicted_class_good
Whether to include predicted class good
- Type: boolean (details)
- show_predicted_class_featured
Whether to included predicted class featured
- Type: boolean (details)
- show_predicted_issues_vandalism
Whether to include potential issues of vandalism
- Type: boolean (details)
- show_predicted_issues_spam
Whether to include potential issues of spam
- Type: boolean (details)
- show_predicted_issues_attack
Whether to include potential issues of attack
- Type: boolean (details)
- show_predicted_issues_none
Whether to include no potential issues
- Type: boolean (details)
- show_predicted_issues_copyvio
Whether to include potential issues of copyvio
- Type: boolean (details)
- showbots
Whether to include only pages created by bots.
- Type: boolean (details)
- showautopatrolled
Whether to show only edits by users with the autopatrol user right.
- Type: boolean (details)
- showredirs
Whether to include redirects.
- Type: boolean (details)
- showothers
Whether to include normal pages that are not redirects nor nominated for deletion.
- Type: boolean (details)
- showreviewed
Whether to include reviewed.
- Type: boolean (details)
- showunreviewed
Whether to include unreviewed.
- Type: boolean (details)
- showdeleted
Whether to include "proposed for deletion".
- Type: boolean (details)
- namespace
What namespace to pull stats from.
- Type: integer
- afc_state
Which Articles-for-Creation state to get stats for.
- Type: integer
- no_category
Whether to include only pages with no category.
- Type: boolean (details)
- unreferenced
Whether to include only pages with no references.
- Type: boolean (details)
- no_inbound_links
Whether to include only pages with no inbound links.
- Type: boolean (details)
- recreated
Whether to include only pages that were previously deleted.
- Type: boolean (details)
- non_autoconfirmed_users
Whether to include only pages created by non-autoconfirmed users.
- Type: boolean (details)
- learners
Whether to include only pages created by newly autoconfirmed users.
- Type: boolean (details)
- blocked_users
Whether to include only pages created by blocked users.
- Type: boolean (details)
- username
Include only pages created by username.
- Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
- keyword
Include only pages with this keyword in the snippet.
- date_range_from
Include only pages created on this date and after.
- Type: timestamp (allowed formats)
- date_range_to
Include only pages created on this date and before.
- Type: timestamp (allowed formats)
action=pagetriagetagcopyvio
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: PageTriage
- License: MIT
Tag a revision as a likely copyright violation.
The revision is shown on Special:NewPagesFeed. Requires the pagetriage-copyvio right.
- revid
Revision ID to tag as a likely copyright violation
- This parameter is required.
- Type: integer
- untag
Remove the copyright violation tag
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=pagetriagetagging
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: PageTriage
- License: MIT
Add tags to an article.
- pageid
The article for which to be tagged.
- This parameter is required.
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- wikitext
The wikitext containing the tag added to the article.
- This parameter is required.
- deletion
Whether or not the tagging is for a deletion nomination.
- Type: boolean (details)
- note
Personal note to page creators from reviewers.
- Default: (empty)
- taglist
Pipe-separated list of tags.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
action=paraminfo
- Source: MediaWiki
- License: GPL-2.0-or-later
Obtain information about API modules.
- modules
List of module names (values of the action and format parameters, or main). Can specify submodules with a +, or all submodules with +*, or all submodules recursively with +**.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- helpformat
Format of help strings.
- One of the following values: html, none, raw, wikitext
- Default: none
- querymodules
- Deprecated.
List of query module names (value of prop, meta or list parameter). Use modules=query+foo instead of querymodules=foo.
- Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allmessages, allpages, allredirects, allrevisions, alltransclusions, allusers, authmanagerinfo, automatictranslationdenselanguages, babel, backlinks, betafeatures, blocks, categories, categoryinfo, categorymembers, centralnoticeactivecampaigns, centralnoticelogs, checkuser, checkuserformattedblockinfo, checkuserlog, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, codexicons, communityconfiguration, contenttranslation, contenttranslationcorpora, contenttranslationfavoritesuggestions, contributors, coordinates, cxconfig, cxdeletedtranslations, cxpublishedtranslations, cxtranslatorstats, deletedrevisions, deletedrevs, description, duplicatefiles, embeddedin, extlinks, extracts, exturlusage, featureusage, filearchive, filerepoinfo, fileusage, flagged, gadgetcategories, gadgets, geosearch, globalallusers, globalblocks, globalgroups, globalpreferences, globalrenamestatus, globalusage, globaluserinfo, globalusers, growthimagesuggestiondata, growthmenteestatus, growthmentorlist, growthmentormentee, growthmentorstatus, growthnextsuggestedtasktype, growthstarredmentees, growthtasks, imageinfo, images, imageusage, info, isreviewed, iwbacklinks, iwlinks, langbacklinks, langlinks, langlinkscount, languageinfo, links, linkshere, linterrors, linterstats, logevents, mapdata, mmcontent, mostviewed, mystashedfiles, notifications, oldreviewedpages, ores, pageassessments, pagecollectionsmetadata, pageimages, pagepropnames, pageprops, pageswithprop, pageterms, pageviews, prefixsearch, projectpages, projects, protectedtitles, querypage, random, readinglistentries, readinglists, recentchanges, redirects, revisions, search, siteinfo, siteviews, stashimageinfo, tags, templates, tokens, trackingcategories, transcludedin, transcodestatus, unreadnotificationpages, usercontribs, userinfo, users, videoinfo, watchlist, watchlistraw, wbentityusage, wblistentityusage, wikibase, wikisets
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- mainmodule
- Deprecated.
Get information about the main (top-level) module as well. Use modules=main instead.
- pagesetmodule
- Deprecated.
Get information about the pageset module (providing titles= and friends) as well.
- formatmodules
- Deprecated.
List of format module names (value of format parameter). Use modules instead.
- Values (separate with | or alternative): json, jsonfm, none, rawfm, xml, xmlfm
- Show info for action=parse, format=jsonfm, action=query&list=allpages, and action=query&meta=siteinfo.
- api.php?action=paraminfo&modules=parse|phpfm|query%2Ballpages|query%2Bsiteinfo [open in sandbox]
- Show info for all submodules of action=query.
- api.php?action=paraminfo&modules=query%2B* [open in sandbox]
action=parse
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Parses content and returns parser output.
See the various prop-modules of action=query to get information from the current version of a page.
There are several ways to specify the text to parse:
- Specify a page or revision, using page, pageid, or oldid.
- Specify content explicitly, using text, title, revid, and contentmodel.
- Specify only a summary to parse. prop should be given an empty value.
- title
Title of page the text belongs to. If omitted, contentmodel must be specified, and API will be used as the title.
- text
Text to parse. Use title or contentmodel to control the content model.
- revid
Revision ID, for
{{REVISIONID}}and similar variables.- Type: integer
- summary
Summary to parse.
- page
Parse the content of this page. Cannot be used together with text and title.
- pageid
Parse the content of this page. Overrides page.
- Type: integer
- redirects
If page or pageid is set to a redirect, resolve it.
- Type: boolean (details)
- oldid
Parse the content of this revision. Overrides page and pageid.
- Type: integer
- prop
Which pieces of information to get:
- text
- Gives the parsed text of the wikitext.
- langlinks
- Gives the language links in the parsed wikitext.
- categories
- Gives the categories in the parsed wikitext.
- categorieshtml
- Gives the HTML version of the categories.
- links
- Gives the internal links in the parsed wikitext.
- templates
- Gives the templates in the parsed wikitext.
- images
- Gives the images in the parsed wikitext.
- externallinks
- Gives the external links in the parsed wikitext.
- sections
- Deprecated. prop=sections has been deprecated. Please use prop=tocdata instead.Gives the sections in the parsed wikitext.
- tocdata
- Gives the table of contents information in the parsed wikitext. See mw:API:Parsing_wikitext/TOCData for schema.
- revid
- Adds the revision ID of the parsed page.
- displaytitle
- Adds the title of the parsed wikitext.
- subtitle
- Adds the page subtitle for the parsed page.
- headhtml
- Gives parsed doctype, opening
<html>,<head>element and opening<body>of the page. - modules
- Gives the ResourceLoader modules used on the page. To load, use
mw.loader.using(). Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules. - jsconfigvars
- Gives the JavaScript configuration variables specific to the page. To apply, use
mw.config.set(). - encodedjsconfigvars
- Gives the JavaScript configuration variables specific to the page as a JSON string.
- indicators
- Gives the HTML of page status indicators used on the page.
- iwlinks
- Gives interwiki links in the parsed wikitext.
- wikitext
- Gives the original wikitext that was parsed.
- properties
- Gives various properties defined in the parsed wikitext.
- limitreportdata
- Gives the limit report in a structured way. Gives no data, when disablelimitreport is set.
- limitreporthtml
- Gives the HTML version of the limit report. Gives no data, when disablelimitreport is set.
- parsetree
- The XML parse tree of revision content (requires content model
wikitext) - parsewarnings
- Gives the warnings that occurred while parsing content (as wikitext).
- parsewarningshtml
- Gives the warnings that occurred while parsing content (as HTML).
- headitems
- Deprecated. prop=headitems is deprecated since MediaWiki 1.28. Use prop=headhtml when creating new HTML documents, or prop=modules|jsconfigvars when updating a document client-side.Gives items to put in the
<head>of the page.
- Values (separate with | or alternative): categories, categorieshtml, displaytitle, encodedjsconfigvars, externallinks, headhtml, images, indicators, iwlinks, jsconfigvars, langlinks, limitreportdata, limitreporthtml, links, modules, parsetree, parsewarnings, parsewarningshtml, properties, revid, subtitle, templates, text, tocdata, wikitext, headitems, sections
- Default: text|langlinks|categories|links|templates|images|externallinks|sections|tocdata|revid|displaytitle|iwlinks|properties|parsewarnings
- wrapoutputclass
CSS class to use to wrap the parser output.
- Default: mw-parser-output
- usearticle
Use the ArticleParserOptions hook to ensure the options used match those used for article page views
- Type: boolean (details)
- parsoid
- Deprecated.
Generate HTML conforming to the MediaWiki DOM spec using Parsoid. Replaced by parser=parsoid.
- Type: boolean (details)
- parser
Which wikitext parser to use:
- parsoid
- Generate HTML conforming to the MediaWiki DOM spec using Parsoid.
- default
- Generate HTML using this wiki's default parser.
- legacy
- Generate HTML using the legacy parser.
- One of the following values: default, legacy, parsoid
- Default: default
- pst
Do a pre-save transform on the input before parsing it. Only valid when used with text.
- Type: boolean (details)
- onlypst
Do a pre-save transform (PST) on the input, but don't parse it. Returns the same wikitext, after a PST has been applied. Only valid when used with text.
- Type: boolean (details)
- effectivelanglinks
- Deprecated.
Includes language links supplied by extensions (for use with prop=langlinks).
- Type: boolean (details)
- section
Only parse the content of the section with this identifier.
When new, parse text and sectiontitle as if adding a new section to the page.
new is allowed only when specifying text.
- sectiontitle
New section title when section is new.
Unlike page editing, this does not fall back to summary when omitted or empty.
- disablepp
- Deprecated.
Use disablelimitreport instead.
- Type: boolean (details)
- disablelimitreport
Omit the limit report ("NewPP limit report") from the parser output.
- Type: boolean (details)
- disableeditsection
Omit edit section links from the parser output.
- Type: boolean (details)
- disablestylededuplication
Do not deduplicate inline stylesheets in the parser output.
- Type: boolean (details)
- showstrategykeys
Whether to include internal merge strategy information in jsconfigvars.
- Type: boolean (details)
- generatexml
- Deprecated.
Generate XML parse tree (requires content model
wikitext; replaced by prop=parsetree).- Type: boolean (details)
- preview
Parse in preview mode.
- Type: boolean (details)
- sectionpreview
Parse in section preview mode (enables preview mode too).
- Type: boolean (details)
- disabletoc
Omit table of contents in output.
- Type: boolean (details)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
- contentformat
Content serialization format used for the input text. Only valid when used with text.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- contentmodel
Content model of the input text. If omitted, title must be specified, and default will be the model of the specified title. Only valid when used with text.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- mobileformat
Return parse output in a format suitable for mobile devices.
- Type: boolean (details)
- templatesandboxprefix
Template sandbox prefix, as with Special:TemplateSandbox.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- templatesandboxtitle
Parse the page using templatesandboxtext in place of the contents of the page named here.
- templatesandboxtext
Parse the page using this page content in place of the page named by templatesandboxtitle.
- templatesandboxcontentmodel
Content model of templatesandboxtext.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- templatesandboxcontentformat
Content format of templatesandboxtext.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- Parse a page.
- api.php?action=parse&page=Project:Sandbox [open in sandbox]
- Parse wikitext.
- api.php?action=parse&text={{Project:Sandbox}}&contentmodel=wikitext [open in sandbox]
- Parse wikitext, specifying the page title.
- api.php?action=parse&text={{PAGENAME}}&title=Test [open in sandbox]
- Parse a summary.
- api.php?action=parse&summary=Some+[[link]]&prop= [open in sandbox]
action=parser-migration
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: ParserMigration
- License: CC0-1.0
Parse a page with two different parser configurations.
- title
The title of the page to load and parse.
- This parameter is required.
- config
The parser configuration to use. May be "old", "new" or "old|new".
- old
- Parses the page using the "old" configuration; MediaWiki's legacy parser
- new
- Parses the page using the "new" configuration; Parsoid
- Values (separate with | or alternative): new, old
- Default: old|new
- redirect
Redirects are followed by default. Use "no" to not follow redirects.
action=patrol
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Patrol a page or revision.
- rcid
Recentchanges ID to patrol.
- Type: integer
- revid
Revision ID to patrol.
- Type: integer
Change tags to apply to the entry in the patrol log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "patrol" token retrieved from action=query&meta=tokens
- This parameter is required.
- Patrol a recent change.
- api.php?action=patrol&token=123ABC&rcid=230672766 [open in sandbox]
- Patrol a revision.
- api.php?action=patrol&token=123ABC&revid=230672766 [open in sandbox]
action=protect
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the protection level of a page.
- title
Title of the page to (un)protect. Cannot be used together with pageid.
- pageid
ID of the page to (un)protect. Cannot be used together with title.
- Type: integer
- protections
List of protection levels, formatted action=level (e.g. edit=sysop). A level of all means everyone is allowed to take the action, i.e. no restriction.
Note: Any actions not listed will have restrictions removed.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- expiry
Expiry timestamps. If only one timestamp is set, it'll be used for all protections. Use infinite, indefinite, infinity, or never, for a never-expiring protection.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: infinite
- reason
Reason for (un)protecting.
- Default: (empty)
Change tags to apply to the entry in the protection log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- cascade
Enable cascading protection (i.e. protect transcluded templates and images used in this page). Ignored if none of the given protection levels support cascading.
- Type: boolean (details)
- watch
- Deprecated.
If set, add the page being (un)protected to the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Protect a page.
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=edit=sysop|move=sysop&cascade=&expiry=20070901163000|never [open in sandbox]
- Unprotect a page by setting restrictions to all (i.e. everyone is allowed to take the action).
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=edit=all|move=all&reason=Lifting%20restrictions [open in sandbox]
- Unprotect a page by setting no restrictions.
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=&reason=Lifting%20restrictions [open in sandbox]
action=purge
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Purge the cache for the given titles.
- forcelinkupdate
Update the links tables and do other secondary data updates.
- Type: boolean (details)
- forcerecursivelinkupdate
Same as forcelinkupdate, and update the links tables for any page that uses this page as a template.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Purge Main Page and the API page.
- api.php?action=purge&titles=Main%20Page|API [open in sandbox]
- Purge the first 10 pages in the main namespace.
- api.php?action=purge&generator=allpages&gapnamespace=0&gaplimit=10 [open in sandbox]
action=query
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Fetch data from and about MediaWiki.
All data modifications will first have to use query to acquire a token to prevent abuse from malicious sites.
- prop
Which properties to get for the queried pages.
- categories
- List all categories the pages belong to.
- categoryinfo
- Returns information about the given categories.
- contributors
- Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
- coordinates
- Returns coordinates of the given pages.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- extlinks
- Returns all external URLs (not interwikis) from the given pages.
- extracts
- Returns plain-text or limited HTML extracts of the given pages.
- fileusage
- Find all pages that use the given files.
- flagged
- Get information about the flagging status of the given pages.
- globalusage
- Returns global image usage for a certain image.
- growthimagesuggestiondata
- Fetch associated image suggestion data, if available
- imageinfo
- Returns file information and upload history.
- images
- Returns all files contained on the given pages.
- info
- Get basic page information.
- isreviewed
- Determine if a page is marked as reviewed.
- iwlinks
- Returns all interwiki links from the given pages.
- langlinks
- Returns all interlanguage links from the given pages.
- langlinkscount
- Get the number of other language versions.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mmcontent
- Get the description and targets of a spamlist
- pageassessments
- Return associated projects and assessments for the given pages.
- pageimages
- Returns information about images on the page, such as thumbnail and presence of photos.
- pageprops
- Get various page properties defined in the page content.
- pageterms
- Get the Wikidata terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
- pageviews
- Shows per-page pageview data (the number of daily pageviews for each of the last pvipdays days).
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- stashimageinfo
- Returns file information for stashed files.
- templates
- Returns all pages transcluded on the given pages.
- transcludedin
- Find all pages that transclude the given pages.
- transcodestatus
- Get transcode status for a given file page.
- videoinfo
- Extends imageinfo to include video source (derivatives) information
- wbentityusage
- Returns all entity IDs used in the given pages.
- cirrusbuilddoc
- Internal. Dump of a CirrusSearch article document from the database servers
- cirruscompsuggestbuilddoc
- Internal. Dump of the document used by the completion suggester
- cirrusdoc
- Internal. Dump of a CirrusSearch article document from the search servers
- description
- Internal. Get a short description a.k.a. subtitle explaining what the target page is about.
- mapdata
- Internal. Request all Kartographer map data for the given pages
- Values (separate with | or alternative): categories, categoryinfo, contributors, coordinates, deletedrevisions, duplicatefiles, extlinks, extracts, fileusage, flagged, globalusage, growthimagesuggestiondata, imageinfo, images, info, isreviewed, iwlinks, langlinks, langlinkscount, links, linkshere, mmcontent, pageassessments, pageimages, pageprops, pageterms, pageviews, redirects, revisions, stashimageinfo, templates, transcludedin, transcodestatus, videoinfo, wbentityusage, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, description, mapdata
- list
Which lists to get.
- abusefilters
- Show details of the edit filters.
- abuselog
- Show events that were caught by one of the edit filters.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- allusers
- Enumerate all registered users.
- automatictranslationdenselanguages
- Fetch the list of sitelinks for the article that corresponds to a given Wikidata ID, ordered by article size.
- backlinks
- Find all pages that link to the given page.
- betafeatures
- List all BetaFeatures
- blocks
- List all blocked users and IP addresses.
- categorymembers
- List all pages in a given category.
- centralnoticeactivecampaigns
- Get a list of currently active campaigns with start and end dates and associated banners.
- centralnoticelogs
- Get a log of campaign configuration changes.
- checkuserlog
- Get entries from the CheckUser log.
- codexicons
- Get Codex icons
- contenttranslation
- Query Content Translation database for translations.
- contenttranslationcorpora
- Get the section-aligned parallel text for a given translation. See also
list=cxpublishedtranslations. Dumps are provided in different formats for high volume access. - contenttranslationfavoritesuggestions
- Get user's favorite suggestions for Content Translation.
- cxpublishedtranslations
- Fetch all published translations information.
- cxtranslatorstats
- Fetch the translation statistics for the given user.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- filearchive
- Enumerate all deleted files sequentially.
- gadgetcategories
- Returns a list of gadget sections.
- gadgets
- Returns a list of gadgets used on this wiki.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- globalallusers
- Enumerate all global users.
- globalblocks
- List all globally blocked IP addresses.
- globalgroups
- Enumerate all global groups.
- globalusers
- Get information about a list of global users.
- growthmentorlist
- List all the mentors
- growthmentormentee
- Get all mentees assigned to a given mentor
- growthstarredmentees
- Get list of mentees starred by the currently logged in mentor
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- linterrors
- Get a list of lint errors
- logevents
- Get events from logs.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- mystashedfiles
- Get a list of files in the current user's upload stash.
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pagecollectionsmetadata
- Fetch page collection information for the given title.
- pagepropnames
- List all page property names in use on the wiki.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- projects
- List all the projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- search
- Perform a full text search.
- tags
- List change tags.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- usercontribs
- Get all edits by a user.
- users
- Get information about a list of users.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wikisets
- Enumerate all wiki sets.
- checkuser
- Deprecated. This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
- deletedrevs
- Deprecated. list=deletedrevs has been deprecated. Please use prop=deletedrevisions or list=alldeletedrevisions instead.List deleted revisions.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, allusers, automatictranslationdenselanguages, backlinks, betafeatures, blocks, categorymembers, centralnoticeactivecampaigns, centralnoticelogs, checkuserlog, codexicons, contenttranslation, contenttranslationcorpora, contenttranslationfavoritesuggestions, cxpublishedtranslations, cxtranslatorstats, embeddedin, exturlusage, filearchive, gadgetcategories, gadgets, geosearch, globalallusers, globalblocks, globalgroups, globalusers, growthmentorlist, growthmentormentee, growthstarredmentees, imageusage, iwbacklinks, langbacklinks, linterrors, logevents, mostviewed, mystashedfiles, oldreviewedpages, pagecollectionsmetadata, pagepropnames, pageswithprop, prefixsearch, projectpages, projects, protectedtitles, querypage, random, recentchanges, search, tags, trackingcategories, usercontribs, users, watchlist, watchlistraw, wblistentityusage, wikisets, checkuser, deletedrevs, growthtasks, readinglistentries
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- meta
Which metadata to get.
- allmessages
- Return messages from this site.
- authmanagerinfo
- Retrieve information about the current authentication status.
- babel
- Get information about what languages the user knows
- communityconfiguration
- Read the community configuration
- cxconfig
- Get ContentTranslation local configuration settings.
- featureusage
- Get a summary of logged API feature usages for a user agent.
- filerepoinfo
- Return meta information about image repositories configured on the wiki.
- globalpreferences
- Retrieve global preferences for the current user.
- globalrenamestatus
- Show information about global renames that are in progress.
- globaluserinfo
- Show information about a global user.
- growthmenteestatus
- Query current user's mentee status; see documentation of action=growthsetmenteestatus for detailed information about individual statuses.
- growthmentorstatus
- Query current user's mentor status
- languageinfo
- Return information about available languages.
- linterstats
- Get number of lint errors in each category
- notifications
- Get notifications waiting for the current user.
- ores
- Return ORES configuration and model data for this wiki.
- siteinfo
- Return general information about the site.
- siteviews
- Shows sitewide pageview data (daily pageview totals for each of the last pvisdays days).
- tokens
- Gets tokens for data-modifying actions.
- unreadnotificationpages
- Get pages for which there are unread notifications for the current user.
- userinfo
- Get information about the current user.
- wikibase
- Get information about the Wikibase client and the associated Wikibase repository.
- checkuserformattedblockinfo
- Internal. Return formatted block details for sitewide blocks affecting the current user.
- cxdeletedtranslations
- Internal. Get the number of your published translations that were deleted.
- growthnextsuggestedtasktype
- Internal. Get a suggested task type for a user to try next.
- readinglists
- Internal. List or filter the user's reading lists and show metadata about them.
- Values (separate with | or alternative): allmessages, authmanagerinfo, babel, communityconfiguration, cxconfig, featureusage, filerepoinfo, globalpreferences, globalrenamestatus, globaluserinfo, growthmenteestatus, growthmentorstatus, languageinfo, linterstats, notifications, ores, siteinfo, siteviews, tokens, unreadnotificationpages, userinfo, wikibase, checkuserformattedblockinfo, cxdeletedtranslations, growthnextsuggestedtasktype, readinglists
- indexpageids
Include an additional pageids section listing all returned page IDs.
- Type: boolean (details)
- export
Export the current revisions of all given or generated pages.
- Type: boolean (details)
- exportnowrap
Return the export XML without wrapping it in an XML result (same format as Special:Export). Can only be used with query+export.
- Type: boolean (details)
- exportschema
Target the given version of the XML dump format when exporting. Can only be used with query+export.
- One of the following values: 0.10, 0.11
- Default: 0.11
- iwurl
Whether to get the full URL if the title is an interwiki link.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- rawcontinue
Return raw query-continue data for continuation.
- Type: boolean (details)
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
- redirects
Automatically resolve redirects in query+titles, query+pageids, and query+revids, and in pages returned by query+generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Fetch site info and revisions of Main Page.
- api.php?action=query&prop=revisions&meta=siteinfo&titles=Main%20Page&rvprop=user|comment&continue= [open in sandbox]
- Fetch revisions of pages beginning with API/.
- api.php?action=query&generator=allpages&gapprefix=API/&prop=revisions&continue= [open in sandbox]
prop=categories (cl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all categories the pages belong to.
- clprop
Which additional properties to get for each category:
- sortkey
- Adds the sortkey (hexadecimal string) and sortkey prefix (human-readable part) for the category.
- timestamp
- Adds timestamp of when the category was added.
- hidden
- Tags categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, sortkey, timestamp
- clshow
Which kind of categories to show.
- Values (separate with | or alternative): !hidden, hidden
- cllimit
How many categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- clcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- clcategories
Only list these categories. Useful for checking whether a certain page is in a certain category.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- cldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get a list of categories the page Albert Einstein belongs to.
- api.php?action=query&prop=categories&titles=Albert%20Einstein [open in sandbox]
- Get information about all categories used in the page Albert Einstein.
- api.php?action=query&generator=categories&titles=Albert%20Einstein&prop=info [open in sandbox]
prop=categoryinfo (ci)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns information about the given categories.
- cicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get information about Category:Foo and Category:Bar.
- api.php?action=query&prop=categoryinfo&titles=Category:Foo|Category:Bar [open in sandbox]
prop=cirrusbuilddoc (cb)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of a CirrusSearch article document from the database servers
- cbbuilders
Type of data to extract
- Values (separate with | or alternative): content, links
- Default: content|links
- cblimiterprofile
Profile to use when limiting the size of the document
- Get a dump of a single CirrusSearch article generated from the database.
- api.php?action=query&prop=cirrusbuilddoc&titles=Main_Page [open in sandbox]
prop=cirruscompsuggestbuilddoc (csb)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of the document used by the completion suggester
- csbmethod
Provide a score method name to be used by the completion suggester
- Default: popqual
prop=cirrusdoc (cd)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of a CirrusSearch article document from the search servers
- cdincludes
Define which fields should be returned by the search.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: all
- Get a dump of a single CirrusSearch article as currently indexed into search.
- api.php?action=query&prop=cirrusdoc&titles=Main_Page [open in sandbox]
- Get a dump of CirrusSearch settings for this wiki with just the Categories that have been selected using the 'includes' parameter
- api.php?action=query&prop=cirrusdoc&titles=Main_Page&cdincludes=category [open in sandbox]
prop=contributors (pc)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
- pcgroup
Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- pcexcludegroup
Exclude users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- pcrights
Only include users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, collectionsaveascommunitypage, collectionsaveasuserpage, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, patrol, patrolmarks, protect, read, renameuser, renameuser-global, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pcexcluderights
Exclude users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, collectionsaveascommunitypage, collectionsaveasuserpage, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, patrol, patrolmarks, protect, read, renameuser, renameuser-global, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pclimit
How many contributors to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show contributors to the page Main Page.
- api.php?action=query&prop=contributors&titles=Main%20Page [open in sandbox]
prop=coordinates (co)
- This module requires read rights.
- Source: GeoData
- License: WTFPL
Returns coordinates of the given pages.
- colimit
How many coordinates to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- cocontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- coprop
Which additional coordinate properties to return. (Properties that are always returned: lat, lon, and either primary or secondary as a boolean flag.)
- type
- Type of the object the coordinates point to. See mw:Special:MyLanguage/Extension:GeoData#Usage for details.
- name
- Name of the object.
- dim
- Approximate size of the object in meters.
- country
- ISO 3166-1 alpha-2 country code (e.g. US or RU).
- region
- ISO 3166-2 region code (the part of the ISO 3166-2 code after the dash; e.g. FL or MOS).
- globe
- Which terrestrial body the coordinates are relative to (e.g. moon or pluto). Defaults to Earth. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.
- Values (separate with | or alternative): country, dim, globe, name, region, type
- Default: globe
- coprimary
Which kind of coordinates to return.
- primary
- The location of the subject of the article. There is at most one primary coordinate per title.
- secondary
- The location of some object that's mentioned in the article. Any number of secondary coordinates can be associated with a title.
- all
- Return both primary and secondary coordinates.
- One of the following values: all, primary, secondary
- Default: primary
- codistancefrompoint
Return distance in meters from the geographical coordinates of every valid result from the given coordinates.
Format: Latitude and longitude separated by pipe (|).
- codistancefrompage
Return distance in meters from the geographical coordinates of every valid result from the coordinates of this page.
- Get a list of coordinates of the Main Page
- api.php?action=query&prop=coordinates&titles=Main%20Page [open in sandbox]
prop=deletedrevisions (drv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get deleted revision information.
May be used in several ways:
- Get deleted revisions for a set of pages, by setting titles or pageids. Ordered by title and timestamp.
- Get data about a set of deleted revisions by setting their IDs with revids. Ordered by revision ID.
- drvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, drvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, drvlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- drvslots
Which revision slots to return data for, when slot-related properties are included in drvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- drvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of drvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- drvlimit
Limit how many revisions will be returned. If drvprop=content, drvprop=parsetree, drvdiffto or drvdifftotext is used, the limit is 50. If drvparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- drvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires drvprop=content).
- Type: boolean (details)
- drvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires drvprop=content).
- Type: boolean (details)
- drvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires drvprop=content). For performance reasons, if this option is used, drvlimit is enforced to 1.
- Type: boolean (details)
- drvsection
Only retrieve the content of the section with this identifier.
- drvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, drvlimit is enforced to 50.
- drvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides drvdiffto. If drvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, drvlimit is enforced to 50.
- drvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with drvdifftotext.
- Type: boolean (details)
- drvcontentformat
- Deprecated.
Serialization format used for drvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- drvstart
The timestamp to start enumerating from. Ignored when processing a list of revision IDs.
- Type: timestamp (allowed formats)
- drvend
The timestamp to stop enumerating at. Ignored when processing a list of revision IDs.
- Type: timestamp (allowed formats)
- drvdir
In which direction to enumerate:
- newer
- List oldest first. Note: drvstart has to be before drvend.
- older
- List newest first (default). Note: drvstart has to be later than drvend.
- One of the following values: newer, older
- Default: older
- drvtag
Only list revisions tagged with this tag.
- drvuser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drvexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the information for deleted revision 123456.
- api.php?action=query&prop=deletedrevisions&revids=123456 [open in sandbox]
- List the deleted revisions of the pages Main Page and its talk page with content.
- api.php?action=query&prop=deletedrevisions&titles=Main%20Page|Talk%3AMain%20Page&drvslots=*&drvprop=user|comment|content [open in sandbox]
prop=description (desc)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get a short description a.k.a. subtitle explaining what the target page is about.
The description is plain text, on a single line, but otherwise arbitrary (potentially including raw HTML tags, which also should be interpreted as plain text). It must not be used in HTML unescaped!
- desccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- descprefersource
Which description source to prefer if present:
- local
- Local descriptions via
{{SHORTDESC:...}}parser function in the wikitext of the page. - central
- Central descriptions from the associated Wikidata item.
- One of the following values: central, local
- Default: local
- Get the description for the page 'London'.
- api.php?action=query&prop=description&titles=London [open in sandbox]
- Get the description for the page 'London', preferring the central description if it exists.
- api.php?action=query&prop=description&titles=London&descprefersource=central [open in sandbox]
prop=duplicatefiles (df)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all files that are duplicates of the given files based on hash values.
- dflimit
How many duplicate files to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- dfcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- dfdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- dflocalonly
Look only for files in the local repository.
- Type: boolean (details)
- Look for duplicates of File:Albert Einstein Head.jpg.
- api.php?action=query&titles=File:Albert_Einstein_Head.jpg&prop=duplicatefiles [open in sandbox]
- Look for duplicates of all files.
- api.php?action=query&generator=allimages&prop=duplicatefiles [open in sandbox]
prop=extlinks (el)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all external URLs (not interwikis) from the given pages.
- ellimit
How many links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- elcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- elprotocol
Protocol of the URL. If empty and elquery is set, the protocol is http and https. Leave both this and elquery empty to list all external links.
- One of the following values: Can be empty, or bitcoin, commonsfinder, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
- Default: (empty)
- elquery
Search string without protocol. Useful for checking whether a certain page contains a certain external url.
- elexpandurl
- Deprecated.
Expand protocol-relative URLs with the canonical protocol.
- Type: boolean (details)
- Get a list of external links on the page Main Page.
- api.php?action=query&prop=extlinks&titles=Main%20Page [open in sandbox]
prop=extracts (ex)
- This module requires read rights.
- Source: TextExtracts
- License: GPL-2.0-or-later
Returns plain-text or limited HTML extracts of the given pages.
- exchars
How many characters to return. Actual text returned might be slightly longer.
- Type: integer
- The value must be between 1 and 1,200.
- exsentences
How many sentences to return.
- Type: integer
- The value must be between 1 and 10.
- exlimit
How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)
- Type: integer or max
- The value must be between 1 and 20.
- Default: 20
- exintro
Return only content before the first section.
- Type: boolean (details)
- explaintext
Return extracts as plain text instead of limited HTML.
- Type: boolean (details)
- exsectionformat
How to format sections in plaintext mode:
- plain
- No formatting.
- wiki
- Wikitext-style formatting (== like this ==).
- raw
- This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
- One of the following values: plain, raw, wiki
- Default: wiki
- excontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Get a 175-character extract
- api.php?action=query&prop=extracts&exchars=175&titles=Therion [open in sandbox]
prop=fileusage (fu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that use the given files.
- fuprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- funamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- fushow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- fulimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- fucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages using File:Example.jpg.
- api.php?action=query&prop=fileusage&titles=File%3AExample.jpg [open in sandbox]
- Get information about pages using File:Example.jpg.
- api.php?action=query&generator=fileusage&titles=File%3AExample.jpg&prop=info [open in sandbox]
prop=flagged
- This module requires read rights.
- Source: FlaggedRevs (Pending Changes)
- License: GPL-2.0-or-later
Get information about the flagging status of the given pages.
If a page is flagged, the following parameters are returned:
- stable_revid
- The revision ID of the latest stable revision.
- level
- level_text
- The highest flagging level of the page.
- pending_since
- If there are any current unreviewed revisions for that page, holds the timestamp of the first of them.
If the page has protection configuration, the following parameters are returned:
- protection_level
- The right a user must have to not require review on the page.
- protection_expiry
- When the protection expires.
- Get page information and flag status of Main Page
- api.php?action=query&prop=info|flagged&titles=Main%20Page [open in sandbox]
- Get flag statuses for pages starting with "K"
- api.php?action=query&generator=allpages&gapfrom=K&prop=flagged [open in sandbox]
prop=globalusage (gu)
- This module requires read rights.
- Source: Global Usage
- License: MIT
Returns global image usage for a certain image.
- guprop
Which properties to return:
- url
- Adds url.
- pageid
- Adds page ID.
- namespace
- Adds namespace ID.
- Values (separate with | or alternative): namespace, pageid, url
- Default: url
- gulimit
How many links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- gunamespace
Limit results to these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: *
- gusite
Limit results to these sites.
- Values (separate with | or alternative): aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, alswikibooks, alswikiquote, alswiktionary, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fixcopyrightwiki, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, labtestwiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mowiki, mowiktionary, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikimedia, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zerowiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- gucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- gufilterlocal
Filter local usage of the file.
- Type: boolean (details)
prop=growthimagesuggestiondata (gisd)
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Fetch associated image suggestion data, if available
- gisdtasktype
Task type ID (to specify whether to fetch data for top-level or section-level image recommendations)
- One of the following values: image-recommendation, section-image-recommendation
- Default: image-recommendation
- gisdcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
prop=imageinfo (ii)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns file information and upload history.
- iiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- thumbmime
- Adds MIME type of the image thumbnail (requires url and param iiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
- mediatype
- Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- archivename
- Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- uploadwarning
- Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timestamp, uploadwarning, url, user, userid
- Default: timestamp|user
- iilimit
How many file revisions to return per file.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 1
- iistart
Timestamp to start listing from.
- Type: timestamp (allowed formats)
- iiend
Timestamp to stop listing at.
- Type: timestamp (allowed formats)
- iiurlwidth
If iiprop=url is set, a URL to an image scaled to this width will be returned.
For performance reasons if this option is used, no more than 50 scaled images will be returned.
- Type: integer
- Default: -1
- iiurlheight
Similar to iiurlwidth.
- Type: integer
- Default: -1
- iimetadataversion
Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.
- Default: 1
- iiextmetadatalanguage
What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.
- Default: en
- iiextmetadatamultilang
If translations for extmetadata property are available, fetch all of them.
- Type: boolean (details)
- iiextmetadatafilter
If specified and non-empty, only these keys will be returned for iiprop=extmetadata.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- iiurlparam
A handler specific parameter string. For example, PDFs might use page15-100px. iiurlwidth must be used and be consistent with iiurlparam.
- Default: (empty)
- iibadfilecontexttitle
If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list
- iicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iilocalonly
Look only for files in the local repository.
- Type: boolean (details)
- Fetch information about the current version of File:Albert Einstein Head.jpg.
- api.php?action=query&titles=File:Albert%20Einstein%20Head.jpg&prop=imageinfo [open in sandbox]
- Fetch information about versions of File:Test.jpg from 2008 and later.
- api.php?action=query&titles=File:Test.jpg&prop=imageinfo&iilimit=50&iiend=2007-12-31T23:59:59Z&iiprop=timestamp|user|url [open in sandbox]
prop=images (im)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all files contained on the given pages.
- imlimit
How many files to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- imcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- imimages
Only list these files. Useful for checking whether a certain page has a certain file.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- imdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get a list of files used on the page Main Page.
- api.php?action=query&prop=images&titles=Main%20Page [open in sandbox]
- Get information about all files used on the page Main Page.
- api.php?action=query&generator=images&titles=Main%20Page&prop=info [open in sandbox]
prop=info (in)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get basic page information.
- inprop
Which additional properties to get:
- protection
- List the protection level of each page.
- talkid
- The page ID of the talk page for each non-talk page.
- watched
- List the watched status of each page.
- watchlistlabels
- List the watchlist labels for each page.
- watchers
- The number of watchers, if allowed.
- visitingwatchers
- The number of watchers of each page who have visited recent edits to that page, if allowed.
- notificationtimestamp
- The watchlist notification timestamp of each page.
- subjectid
- The page ID of the parent page for each talk page.
- associatedpage
- The prefixed title of the associated subject or talk page.
- url
- Gives a full URL, an edit URL, and the canonical URL for each page.
- readable
- Deprecated. Whether the user can read this page. Use intestactions=read instead.
- preload
- Deprecated. Gives the text returned by EditFormPreloadText. Use preloadcontent instead, which supports other kinds of preloaded text too.
- preloadcontent
- Gives the content to be shown in the editor when the page does not exist or while adding a new section.
- editintro
- Gives the intro messages that should be shown to the user while editing this page or revision, as HTML.
- displaytitle
- Gives the manner in which the page title is actually displayed.
- varianttitles
- Gives the display title in all variants of the site content language.
- linkclasses
- Gives the additional CSS classes (e.g. link colors) used for links to this page if they were to appear on the page named by inlinkcontext.
- Values (separate with | or alternative): associatedpage, displaytitle, editintro, linkclasses, notificationtimestamp, preloadcontent, protection, subjectid, talkid, url, varianttitles, visitingwatchers, watched, watchers, watchlistlabels, preload, readable
- inlinkcontext
The context title to use when determining extra CSS classes (e.g. link colors) when inprop contains linkclasses.
- Type: page title
- Accepts non-existent pages.
- Default: Main Page
- indefaultlinkcaption
Whether to consider the links as having a default caption (caption is a suffix of link target and preceded by slash, colon or start-of-string). It can have impact on the returned link classes.
- Type: boolean (details)
- intestactions
Test whether the current user can perform certain actions on the page.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- intestactionsdetail
Detail level for intestactions. Use the main module's errorformat and errorlang parameters to control the format of the messages returned.
- boolean
- Return a boolean value for each action.
- full
- Return messages describing why the action is disallowed, or an empty array if it is allowed.
- quick
- Like full but skipping expensive checks.
- One of the following values: boolean, full, quick
- Default: boolean
- intestactionsautocreate
Test whether performing intestactions would automatically create a temporary account.
- Type: boolean (details)
- inpreloadcustom
Title of a custom page to use as preloaded content.
- Only used when inprop contains preloadcontent.
- inpreloadparams
Parameters for the custom page being used as preloaded content.
- Only used when inprop contains preloadcontent.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- inpreloadnewsection
Return preloaded content for a new section on the page, rather than a new page.
- Only used when inprop contains preloadcontent.
- Type: boolean (details)
- ineditintrostyle
Some intro messages come with optional wrapper frames. Use moreframes to include them or lessframes to omit them.
- Only used when inprop contains editintro.
- One of the following values: lessframes, moreframes
- Default: moreframes
- ineditintroskip
List of intro messages to remove from the response. Use this if a specific message is not relevant to your tool, or if the information is conveyed in a different way.
- Only used when inprop contains editintro.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ineditintrocustom
Title of a custom page to use as an additional intro message.
- Only used when inprop contains editintro.
- incontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get information about the page Main Page.
- api.php?action=query&prop=info&titles=Main%20Page [open in sandbox]
- Get general and protection information about the page Main Page.
- api.php?action=query&prop=info&inprop=protection&titles=Main%20Page [open in sandbox]
prop=isreviewed
- This module requires read rights.
- Source: PageTriage
- License: MIT
Determine if a page is marked as reviewed.
- Determine if Main Page is marked as reviewed.
- api.php?action=query&prop=isreviewed&titles=Main%20Page [open in sandbox]
prop=iwlinks (iw)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all interwiki links from the given pages.
- iwprop
Which additional properties to get for each interwiki link:
- url
- Adds the full URL.
- Values (separate with | or alternative): url
- iwprefix
Only return interwiki links with this prefix.
- iwtitle
Interwiki link to search for. Must be used with iwprefix.
- iwdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- iwlimit
How many interwiki links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iwcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iwurl
- Deprecated.
Whether to get the full URL (cannot be used with iwprop).
- Type: boolean (details)
- Get interwiki links from the page Main Page.
- api.php?action=query&prop=iwlinks&titles=Main%20Page [open in sandbox]
prop=langlinks (ll)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all interlanguage links from the given pages.
- llprop
Which additional properties to get for each interlanguage link:
- url
- Adds the full URL.
- langname
- Adds the localised language name (best effort). Use llinlanguagecode to control the language.
- autonym
- Adds the native language name.
- Values (separate with | or alternative): autonym, langname, url
- lllang
Only return language links with this language code.
- lltitle
Link to search for. Must be used with lllang.
- lldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- llinlanguagecode
Language code for localised language names.
- Default: en
- lllimit
How many langlinks to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- llcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- llurl
- Deprecated.
Whether to get the full URL (cannot be used with llprop).
- Type: boolean (details)
- Get interlanguage links from the page Main Page.
- api.php?action=query&prop=langlinks&titles=Main%20Page&redirects= [open in sandbox]
prop=langlinkscount
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get the number of other language versions.
- Get the number of other language versions for 'Dog' page
- api.php?action=query&prop=langlinkscount&titles=Dog&redirects=1 [open in sandbox]
prop=links (pl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all links from the given pages.
- plnamespace
Show links in these namespaces only.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- pllimit
How many links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- plcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- pltitles
Only list links to these titles. Useful for checking whether a certain page links to a certain title.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get links from the page Main Page
- api.php?action=query&prop=links&titles=Main%20Page [open in sandbox]
- Get information about the link pages in the page Main Page.
- api.php?action=query&generator=links&titles=Main%20Page&prop=info [open in sandbox]
- Get links from the page Main Page in the User and Template namespaces.
- api.php?action=query&prop=links&titles=Main%20Page&plnamespace=2|10 [open in sandbox]
prop=linkshere (lh)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given pages.
- lhprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- lhnamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- lhshow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- lhlimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lhcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages linking to the Main Page.
- api.php?action=query&prop=linkshere&titles=Main%20Page [open in sandbox]
- Get information about pages linking to the Main Page.
- api.php?action=query&generator=linkshere&titles=Main%20Page&prop=info [open in sandbox]
prop=mapdata (mpd)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Kartographer
- License: MIT
Request all Kartographer map data for the given pages
- mpdgroups
Pipe-separated groups to return data for
- Default: (empty)
- mpdlimit
Data for how many pages to return
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- mpdcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- mpdparser
Which wikitext parser to use
- parsoid
- Generate HTML using Parsoid.
- legacy
- Generate HTML using the legacy parser.
- One of the following values: legacy, parsoid
- Request all map data from the page Metallica
- api.php?action=query&prop=mapdata&titles=Metallica [open in sandbox]
- Request map data in groups group1 and group2 from the page Metallica
- api.php?action=query&prop=mapdata&titles=Metallica&mpdgroups=group1|group2 [open in sandbox]
prop=mmcontent
- This module requires read rights.
- Source: MassMessage
- License: GPL-2.0-or-later
Get the description and targets of a spamlist
- Get page and spamlist information of Spam list
- api.php?action=query&prop=info|mmcontent&titles=Spam%20list [open in sandbox]
prop=pageassessments (pa)
- This module requires read rights.
- Source: PageAssessments
- License: GPL-2.0-or-later
Return associated projects and assessments for the given pages.
- pacontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- palimit
Limit for total number of projects returned (total for all pages).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pasubprojects
Also return assessments by subprojects.
- Type: boolean (details)
- Get project and assessment data for pages Apple and Pear, using the newer API result format.
- api.php?action=query&prop=pageassessments&titles=Apple|Pear&formatversion=2 [open in sandbox]
- Get project and assessment data for page Apple.
- api.php?action=query&prop=pageassessments&titles=Apple [open in sandbox]
- Get project and assessment data (including for subprojects) for page Apple.
- api.php?action=query&prop=pageassessments&titles=Apple&pasubprojects=true [open in sandbox]
prop=pageimages (pi)
- This module requires read rights.
- Source: PageImages
- License: WTFPL
Returns information about images on the page, such as thumbnail and presence of photos.
- piprop
Which information to return:
- thumbnail
- URL and dimensions of thumbnail image associated with page, if any.
- name
- Image title.
- original
- URL and original dimensions of image associated with page, if any.
- Values (separate with | or alternative): name, original, thumbnail
- Default: thumbnail|name
- pithumbsize
Maximum width in pixels of thumbnail images.
- Type: integer
- Default: 50
- pilimit
Properties of how many pages to return.
- Type: integer or max
- The value must be between 1 and 50.
- Default: 50
- pilicense
Limit page images to a certain license type:
- free
- Only free images.
- any
- Best image, whether free or non-free.
- One of the following values: any, free
- Default: free
- picontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- pilangcode
Code for the language the image is going to be rendered in if multiple languages are supported
- Get name and 100-pixel thumbnail of an image on the Albert Einstein page.
- api.php?action=query&prop=pageimages&titles=Albert%20Einstein&pithumbsize=100 [open in sandbox]
prop=pageprops (pp)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get various page properties defined in the page content.
- ppcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ppprop
Only list these page properties (action=query&list=pagepropnames returns page property names in use). Useful for checking whether pages use a certain page property.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get properties for the pages Main Page and MediaWiki.
- api.php?action=query&prop=pageprops&titles=Main%20Page|MediaWiki [open in sandbox]
prop=pageterms (wbpt)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get the Wikidata terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
- wbptcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- wbptlanguage
The language code to get terms in. If not specified, the user language is used.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, ak, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mul, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- Default: uselang
- wbptterms
The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.
- Values (separate with | or alternative): alias, description, label
- Default: alias|label|description
- Get all terms associated with the page 'London', in the user language.
- api.php?action=query&prop=pageterms&titles=London [open in sandbox]
- Get labels and aliases associated with the page 'London', in English.
- api.php?action=query&prop=pageterms&titles=London&wbptterms=label|alias&wbptlanguage=en [open in sandbox]
prop=pageviews (pvip)
- This module requires read rights.
- Source: PageViewInfo
- License: GPL-3.0-or-later
Shows per-page pageview data (the number of daily pageviews for each of the last pvipdays days).
The result format is page title (with underscores) => date (Ymd) => count.
- pvipmetric
The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)
- pageviews
- Plain pageviews.
- One of the following values: pageviews
- Default: pageviews
- pvipdays
The number of days to show.
- Type: integer
- The value must be between 1 and 60.
- Default: 60
- pvipcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show pageview statistics for the main page.
- api.php?action=query&titles=Main_Page&prop=pageviews [open in sandbox]
prop=redirects (rd)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all redirects to the given pages.
- rdprop
Which properties to get:
- pageid
- Page ID of each redirect.
- title
- Title of each redirect.
- fragment
- Fragment of each redirect, if any.
- Values (separate with | or alternative): fragment, pageid, title
- Default: pageid|title
- rdnamespace
Only include pages in these namespaces.
Note: Due to miser mode, using this may result in fewer than rdlimit results returned before continuing; in extreme cases, zero results may be returned.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- rdshow
Show only items that meet these criteria:
- fragment
- Only show redirects with a fragment.
- !fragment
- Only show redirects without a fragment.
- Values (separate with | or alternative): !fragment, fragment
- rdlimit
How many redirects to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- rdcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of redirects to the Main Page.
- api.php?action=query&prop=redirects&titles=Main%20Page [open in sandbox]
- Get information about all redirects to the Main Page.
- api.php?action=query&generator=redirects&titles=Main%20Page&prop=info [open in sandbox]
prop=revisions (rv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get revision information.
May be used in several ways:
- Get data about a set of pages (last revision), by setting titles or pageids.
- Get revisions for one given page, by using titles or pageids with start, end, or limit.
- Get data about a set of revisions by setting their IDs with revids.
- rvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, rvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, rvlimit is enforced to 50. - flagged
- Flagged status of the revision.
- oresscores
- ORES scores for the revision.
- Values (separate with | or alternative): comment, content, contentmodel, flagged, flags, ids, oresscores, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- rvslots
Which revision slots to return data for, when slot-related properties are included in rvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- rvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of rvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- rvlimit
Limit how many revisions will be returned. If rvprop=content, rvprop=parsetree, rvdiffto or rvdifftotext is used, the limit is 50. If rvparse is used, the limit is 1.
- May only be used with a single page (mode #2).
- Type: integer or max
- The value must be between 1 and 500.
- rvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires rvprop=content).
- Type: boolean (details)
- rvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires rvprop=content).
- Type: boolean (details)
- rvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires rvprop=content). For performance reasons, if this option is used, rvlimit is enforced to 1.
- Type: boolean (details)
- rvsection
Only retrieve the content of the section with this identifier.
- rvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, rvlimit is enforced to 50.
- rvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides rvdiffto. If rvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, rvlimit is enforced to 50.
- rvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with rvdifftotext.
- Type: boolean (details)
- rvcontentformat
- Deprecated.
Serialization format used for rvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- rvstartid
Start enumeration from the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.
- May only be used with a single page (mode #2).
- Type: integer
- rvendid
Stop enumeration at the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.
- May only be used with a single page (mode #2).
- Type: integer
- rvstart
From which revision timestamp to start enumeration.
- May only be used with a single page (mode #2).
- Type: timestamp (allowed formats)
- rvend
Enumerate up to this timestamp.
- May only be used with a single page (mode #2).
- Type: timestamp (allowed formats)
- rvdir
In which direction to enumerate:
- newer
- List oldest first. Note: rvstart has to be before rvend.
- older
- List newest first (default). Note: rvstart has to be later than rvend.
- May only be used with a single page (mode #2).
- One of the following values: newer, older
- Default: older
- rvuser
Only include revisions made by user.
- May only be used with a single page (mode #2).
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rvexcludeuser
Exclude revisions made by user.
- May only be used with a single page (mode #2).
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rvtag
Only list revisions tagged with this tag.
- rvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get data with content for the last revision of titles API and Main Page.
- api.php?action=query&prop=revisions&titles=API|Main%20Page&rvslots=*&rvprop=timestamp|user|comment|content [open in sandbox]
- Get last 5 revisions of the Main Page.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment [open in sandbox]
- Get first 5 revisions of the Main Page.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvdir=newer [open in sandbox]
- Get first 5 revisions of the Main Page made after 2006-05-01.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvdir=newer&rvstart=2006-05-01T00:00:00Z [open in sandbox]
- Get first 5 revisions of the Main Page that were not made by anonymous user 127.0.0.1.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvexcludeuser=127.0.0.1 [open in sandbox]
- Get first 5 revisions of the Main Page that were made by the user MediaWiki default.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvuser=MediaWiki%20default [open in sandbox]
prop=stashimageinfo (sii)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns file information for stashed files.
- siifilekey
Key that identifies a previous upload that was stashed temporarily.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- siisessionkey
- Deprecated.
Alias for siifilekey, for backward compatibility.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- siiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- thumbmime
- Adds MIME type of the image thumbnail (requires url and param siiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, commonmetadata, dimensions, extmetadata, metadata, mime, sha1, size, thumbmime, timestamp, url
- Default: timestamp|url
- siiurlwidth
If siiprop=url is set, a URL to an image scaled to this width will be returned.
For performance reasons if this option is used, no more than 50 scaled images will be returned.
- Type: integer
- Default: -1
- siiurlheight
Similar to siiurlwidth.
- Type: integer
- Default: -1
- siiurlparam
A handler specific parameter string. For example, PDFs might use page15-100px. siiurlwidth must be used and be consistent with siiurlparam.
- Default: (empty)
- Returns information for a stashed file.
- api.php?action=query&prop=stashimageinfo&siifilekey=124sd34rsdf567 [open in sandbox]
- Returns thumbnails for two stashed files.
- api.php?action=query&prop=stashimageinfo&siifilekey=b34edoe3|bceffd4&siiurlwidth=120&siiprop=url [open in sandbox]
prop=templates (tl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all pages transcluded on the given pages.
- tlnamespace
Show templates in these namespaces only.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- tllimit
How many templates to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- tlcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- tltemplates
Only list these templates. Useful for checking whether a certain page uses a certain template.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- tldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get the templates used on the page Main Page.
- api.php?action=query&prop=templates&titles=Main%20Page [open in sandbox]
- Get information about the template pages used on the page Main Page.
- api.php?action=query&generator=templates&titles=Main%20Page&prop=info [open in sandbox]
- Get pages in the User and Template namespaces that are transcluded on the page Main Page.
- api.php?action=query&prop=templates&titles=Main%20Page&tlnamespace=2|10 [open in sandbox]
prop=transcludedin (ti)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that transclude the given pages.
- tiprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- tinamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- tishow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- tilimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ticontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages transcluding Main Page.
- api.php?action=query&prop=transcludedin&titles=Main%20Page [open in sandbox]
- Get information about pages transcluding Main Page.
- api.php?action=query&generator=transcludedin&titles=Main%20Page&prop=info [open in sandbox]
prop=transcodestatus
- This module requires read rights.
- Source: TimedMediaHandler
- License: GPL-2.0-or-later
Get transcode status for a given file page.
- Get transcode status for File:Clip.webm
- api.php?action=query&prop=transcodestatus&titles=File:Clip.webm [open in sandbox]
prop=videoinfo (vi)
- This module requires read rights.
- Source: TimedMediaHandler
- License: GPL-2.0-or-later
Extends imageinfo to include video source (derivatives) information
- viprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- thumbmime
- Adds MIME type of the image thumbnail (requires url and param viurlwidth). If the file has been revision deleted, a filehidden property will be returned.
- mediatype
- Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- archivename
- Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- uploadwarning
- Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- derivatives
- Adds an array of the different format and quality versions of an audio or video file that are available.
- timedtext
- Adds an array of the subtitles, captions and descriptions of an audio or video file that are available.
- Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, derivatives, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timedtext, timestamp, uploadwarning, url, user, userid
- Default: timestamp|user
- vilimit
How many file revisions to return per file.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 1
- vistart
Timestamp to start listing from.
- Type: timestamp (allowed formats)
- viend
Timestamp to stop listing at.
- Type: timestamp (allowed formats)
- viurlwidth
If viprop=url is set, a URL to an image scaled to this width will be returned.
For performance reasons if this option is used, no more than 50 scaled images will be returned.
- Type: integer
- Default: -1
- viurlheight
Similar to viurlwidth.
- Type: integer
- Default: -1
- vimetadataversion
Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.
- Default: 1
- viextmetadatalanguage
What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.
- Default: en
- viextmetadatamultilang
If translations for extmetadata property are available, fetch all of them.
- Type: boolean (details)
- viextmetadatafilter
If specified and non-empty, only these keys will be returned for viprop=extmetadata.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- viurlparam
A handler specific parameter string. For example, PDFs might use page15-100px. viurlwidth must be used and be consistent with viurlparam.
- Default: (empty)
- vibadfilecontexttitle
If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list
- vicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- vilocalonly
Look only for files in the local repository.
- Type: boolean (details)
prop=wbentityusage (wbeu)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Returns all entity IDs used in the given pages.
- wbeuprop
Properties to add to the result.
- url
- If enabled url of entity will be added
- Values (separate with | or alternative): url
- wbeuaspect
Only return entity IDs that used this aspect.
- S
- The entity's sitelinks are used
- L
- The entity's label is used
- D
- The entity's description is used
- T
- The title of the local page corresponding to the entity is used
- C
- Statements from the entity are used
- X
- All aspects of an entity are or may be used
- O
- Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
- Values (separate with | or alternative): C, D, L, O, S, T, X
- wbeuentities
Only return page that used these entities.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wbeulimit
How many entity usages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wbeucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get entities used in the page Main Page.
- api.php?action=query&prop=wbentityusage&titles=Main%20Page [open in sandbox]
list=abusefilters (abf)
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Show details of the edit filters.
- abfstartid
The filter ID to start enumerating from.
- Type: integer
- abfendid
The filter ID to stop enumerating at.
- Type: integer
- abfdir
In which direction to enumerate:
- One of the following values: newer, older
- Default: newer
- abfshow
Show only filters which meet these criteria.
- Values (separate with | or alternative): !deleted, !enabled, !private, !protected, deleted, enabled, private, protected
- abflimit
The maximum number of filters to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- abfprop
Which properties to get.
- Values (separate with | or alternative): actions, comments, description, hits, id, lasteditor, lastedittime, pattern, private, protected, status
- Default: id|description|actions|status
- List enabled public filters
- api.php?action=query&list=abusefilters&abfshow=enabled|!private [open in sandbox]
- Show some details about filters
- api.php?action=query&list=abusefilters&abfprop=id|description|pattern [open in sandbox]
list=abuselog (afl)
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Show events that were caught by one of the edit filters.
- afllogid
Show an entry with the given log ID.
- Type: integer
- aflstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- aflend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- afldir
In which direction to enumerate:
- One of the following values: newer, older
- Default: older
- afluser
Show only entries done by a given user or IP address.
- afltitle
Show only entries occurring on a given page.
- aflfilter
Show only entries that were caught by the given filter IDs. Separate with pipes, prefix with "global-" for global filters.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- afllimit
The maximum amount of entries to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- aflprop
Which properties to get.
- Values (separate with | or alternative): action, details, filter, hidden, ids, result, revid, timestamp, title, user
- Default: ids|user|title|action|result|timestamp|hidden|revid
- Show recent log entries
- api.php?action=query&list=abuselog [open in sandbox]
- Show recent log entries for API
- api.php?action=query&list=abuselog&afltitle=API [open in sandbox]
list=allcategories (ac)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all categories.
- acfrom
The category to start enumerating from.
- accontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- acto
The category to stop enumerating at.
- acprefix
Search for all category titles that begin with this value.
- acdir
Direction to sort in.
- One of the following values: ascending, descending
- Default: ascending
- acmin
Only return categories with at least this many members.
- Type: integer
- acmax
Only return categories with at most this many members.
- Type: integer
- aclimit
How many categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- acprop
Which properties to get:
- size
- Adds number of pages in the category.
- hidden
- Tags categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, size
- Default: (empty)
- List categories with information on the number of pages in each.
- api.php?action=query&list=allcategories&acprop=size [open in sandbox]
- Retrieve info about the category page itself for categories beginning List.
- api.php?action=query&generator=allcategories&gacprefix=List&prop=info [open in sandbox]
list=alldeletedrevisions (adr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all deleted revisions by a user or in a namespace.
- adrprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, adrlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, adrlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- adrslots
Which revision slots to return data for, when slot-related properties are included in adrprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- adrcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of adrslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- adrlimit
Limit how many revisions will be returned. If adrprop=content, adrprop=parsetree, adrdiffto or adrdifftotext is used, the limit is 50. If adrparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- adrexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires adrprop=content).
- Type: boolean (details)
- adrgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires adrprop=content).
- Type: boolean (details)
- adrparse
- Deprecated.
Use action=parse instead. Parse revision content (requires adrprop=content). For performance reasons, if this option is used, adrlimit is enforced to 1.
- Type: boolean (details)
- adrsection
Only retrieve the content of the section with this identifier.
- adrdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, adrlimit is enforced to 50.
- adrdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides adrdiffto. If adrsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, adrlimit is enforced to 50.
- adrdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with adrdifftotext.
- Type: boolean (details)
- adrcontentformat
- Deprecated.
Serialization format used for adrdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- adruser
Only list revisions by this user.
Note: Due to miser mode, using adruser and adrnamespace together may result in fewer than adrlimit results returned before continuing; in extreme cases, zero results may be returned.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- adrnamespace
Only list pages in this namespace.
Note: Due to miser mode, using adruser and adrnamespace together may result in fewer than adrlimit results returned before continuing; in extreme cases, zero results may be returned.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- adrstart
The timestamp to start enumerating from.
- May only be used with adruser.
- Type: timestamp (allowed formats)
- adrend
The timestamp to stop enumerating at.
- May only be used with adruser.
- Type: timestamp (allowed formats)
- adrdir
In which direction to enumerate:
- newer
- List oldest first. Note: adrstart has to be before adrend.
- older
- List newest first (default). Note: adrstart has to be later than adrend.
- One of the following values: newer, older
- Default: older
- adrfrom
Start listing at this title.
- Cannot be used with adruser.
- adrto
Stop listing at this title.
- Cannot be used with adruser.
- adrprefix
Search for all page titles that begin with this value.
- Cannot be used with adruser.
- adrexcludeuser
Don't list revisions by this user.
- Cannot be used with adruser.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- adrtag
Only list revisions tagged with this tag.
- adrcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- adrgeneratetitles
When being used as a generator, generate titles rather than revision IDs.
- Type: boolean (details)
- List the last 50 deleted contributions by user Example.
- api.php?action=query&list=alldeletedrevisions&adruser=Example&adrlimit=50 [open in sandbox]
- List the first 50 deleted revisions in the main namespace.
- api.php?action=query&list=alldeletedrevisions&adrdir=newer&adrnamespace=0&adrlimit=50 [open in sandbox]
list=allfileusages (af)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all file usages, including non-existing.
- afcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- affrom
The title of the file to start enumerating from.
- afto
The title of the file to stop enumerating at.
- afprefix
Search for all file titles that begin with this value.
- afunique
Only show distinct file titles. Cannot be used with afprop=ids.
When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- afprop
Which pieces of information to include:
- ids
- Adds the page IDs of the using pages (cannot be used with afunique).
- title
- Adds the title of the file.
- Values (separate with | or alternative): ids, title
- Default: title
- aflimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- afdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List file titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=allfileusages&affrom=B&afprop=ids|title [open in sandbox]
- List unique file titles.
- api.php?action=query&list=allfileusages&afunique=&affrom=B [open in sandbox]
- Gets all file titles, marking the missing ones.
- api.php?action=query&generator=allfileusages&gafunique=&gaffrom=B [open in sandbox]
- Gets pages containing the files.
- api.php?action=query&generator=allfileusages&gaffrom=B [open in sandbox]
list=allimages (ai)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all images sequentially.
- aisort
Property to sort by.
- One of the following values: name, timestamp
- Default: name
- aidir
The direction in which to list.
- One of the following values: ascending, descending, newer, older
- Default: ascending
- aifrom
The image title to start enumerating from. Can only be used with aisort=name.
- aito
The image title to stop enumerating at. Can only be used with aisort=name.
- aicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- aistart
The timestamp to start enumerating from. Can only be used with aisort=timestamp.
- Type: timestamp (allowed formats)
- aiend
The timestamp to end enumerating. Can only be used with aisort=timestamp.
- Type: timestamp (allowed formats)
- aiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- mediatype
- Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, timestamp, url, user, userid
- Default: timestamp|url
- aiprefix
Search for all image titles that begin with this value. Can only be used with aisort=name.
- aiminsize
Limit to images with at least this many bytes.
- Type: integer
- aimaxsize
Limit to images with at most this many bytes.
- Type: integer
- aisha1
SHA1 hash of image. Overrides aisha1base36.
- aisha1base36
SHA1 hash of image in base 36 (used in MediaWiki).
- aiuser
Only return files where the last version was uploaded by this user. Can only be used with aisort=timestamp. Cannot be used together with aifilterbots.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- aifilterbots
How to filter files uploaded by bots. Can only be used with aisort=timestamp. Cannot be used together with aiuser.
- One of the following values: all, bots, nobots
- Default: all
- aimime
Disabled due to miser mode.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ailimit
How many images in total to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Show a list of files starting at the letter B.
- api.php?action=query&list=allimages&aifrom=B [open in sandbox]
- Show a list of recently uploaded files, similar to Special:NewFiles.
- api.php?action=query&list=allimages&aiprop=user|timestamp|url&aisort=timestamp&aidir=older [open in sandbox]
- Show a list of files with MIME type image/png or image/gif
- api.php?action=query&list=allimages&aimime=image/png|image/gif [open in sandbox]
- Show info about 4 files starting at the letter T.
- api.php?action=query&generator=allimages&gailimit=4&gaifrom=T&prop=imageinfo [open in sandbox]
list=alllinks (al)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all links that point to a given namespace.
- alcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- alfrom
The title of the link to start enumerating from.
- alto
The title of the link to stop enumerating at.
- alprefix
Search for all linked titles that begin with this value.
- alunique
Only show distinct linked titles. Cannot be used with alprop=ids.
When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- alprop
Which pieces of information to include:
- ids
- Adds the page ID of the linking page (cannot be used with alunique).
- title
- Adds the title of the link.
- Values (separate with | or alternative): ids, title
- Default: title
- alnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Default: 0
- allimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- aldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List linked titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=alllinks&alfrom=B&alprop=ids|title [open in sandbox]
- List unique linked titles.
- api.php?action=query&list=alllinks&alunique=&alfrom=B [open in sandbox]
- Gets all linked titles, marking the missing ones.
- api.php?action=query&generator=alllinks&galunique=&galfrom=B [open in sandbox]
- Gets pages containing the links.
- api.php?action=query&generator=alllinks&galfrom=B [open in sandbox]
list=allpages (ap)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all pages sequentially in a given namespace.
- apfrom
The page title to start enumerating from.
- apcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- apto
The page title to stop enumerating at.
- apprefix
Search for all page titles that begin with this value.
- apnamespace
The namespace to enumerate.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Default: 0
- apfilterredir
Which pages to list.
Note: Due to miser mode, using this may result in fewer than aplimit results returned before continuing; in extreme cases, zero results may be returned.
- One of the following values: all, nonredirects, redirects
- Default: all
- apfilterlanglinks
Filter based on whether a page has langlinks. Note that this may not consider langlinks added by extensions.
- One of the following values: all, withlanglinks, withoutlanglinks
- Default: all
- apminsize
Limit to pages with at least this many bytes.
- Type: integer
- apmaxsize
Limit to pages with at most this many bytes.
Disabled due to miser mode.
- Type: integer
- apprtype
Limit to protected pages only.
- Values (separate with | or alternative): edit, move, upload
- apprlevel
Filter protections based on protection level (must be used with apprtype= parameter).
- Values (separate with | or alternative): Can be empty, or autoconfirmed, extendedconfirmed, sysop, templateeditor
- apprfiltercascade
Filter protections based on cascadingness (ignored when apprtype isn't set).
- One of the following values: all, cascading, noncascading
- Default: all
- apprexpiry
Which protection expiry to filter the page on:
- indefinite
- Get only pages with indefinite protection expiry.
- definite
- Get only pages with a definite (specific) protection expiry.
- all
- Get pages with any protections expiry.
- One of the following values: all, definite, indefinite
- Default: all
- aplimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- apdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Show a list of pages starting at the letter B.
- api.php?action=query&list=allpages&apfrom=B [open in sandbox]
- Show info about 4 pages starting at the letter T.
- api.php?action=query&generator=allpages&gaplimit=4&gapfrom=T&prop=info [open in sandbox]
- Show content of first 2 non-redirect pages beginning at Re.
- api.php?action=query&generator=allpages&gaplimit=2&gapfilterredir=nonredirects&gapfrom=Re&prop=revisions&rvprop=content [open in sandbox]
list=allredirects (ar)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all redirects to a namespace.
- arcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- arfrom
The title of the redirect to start enumerating from.
- arto
The title of the redirect to stop enumerating at.
- arprefix
Search for all target pages that begin with this value.
- arunique
Only show distinct target pages. Cannot be used with arprop=ids|fragment|interwiki.
When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- arprop
Which pieces of information to include:
- ids
- Adds the page ID of the redirecting page (cannot be used with arunique).
- title
- Adds the title of the redirect.
- fragment
- Adds the fragment from the redirect, if any (cannot be used with arunique).
- interwiki
- Adds the interwiki prefix from the redirect, if any (cannot be used with arunique).
- Values (separate with | or alternative): fragment, ids, interwiki, title
- Default: title
- arnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Default: 0
- arlimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ardir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List target pages, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=allredirects&arfrom=B&arprop=ids|title [open in sandbox]
- List unique target pages.
- api.php?action=query&list=allredirects&arunique=&arfrom=B [open in sandbox]
- Gets all target pages, marking the missing ones.
- api.php?action=query&generator=allredirects&garunique=&garfrom=B [open in sandbox]
- Gets pages containing the redirects.
- api.php?action=query&generator=allredirects&garfrom=B [open in sandbox]
list=allrevisions (arv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all revisions.
- arvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, arvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, arvlimit is enforced to 50. - oresscores
- ORES scores for the revision.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, oresscores, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- arvslots
Which revision slots to return data for, when slot-related properties are included in arvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- arvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of arvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- arvlimit
Limit how many revisions will be returned. If arvprop=content, arvprop=parsetree, arvdiffto or arvdifftotext is used, the limit is 50. If arvparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- arvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires arvprop=content).
- Type: boolean (details)
- arvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires arvprop=content).
- Type: boolean (details)
- arvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires arvprop=content). For performance reasons, if this option is used, arvlimit is enforced to 1.
- Type: boolean (details)
- arvsection
Only retrieve the content of the section with this identifier.
- arvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, arvlimit is enforced to 50.
- arvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides arvdiffto. If arvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, arvlimit is enforced to 50.
- arvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with arvdifftotext.
- Type: boolean (details)
- arvcontentformat
- Deprecated.
Serialization format used for arvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- arvuser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- arvnamespace
Only list pages in this namespace.
Note: Due to miser mode, using this may result in fewer than arvlimit results returned before continuing; in extreme cases, zero results may be returned.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- arvstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- arvend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- arvdir
In which direction to enumerate:
- newer
- List oldest first. Note: arvstart has to be before arvend.
- older
- List newest first (default). Note: arvstart has to be later than arvend.
- One of the following values: newer, older
- Default: older
- arvexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- arvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- arvgeneratetitles
When being used as a generator, generate titles rather than revision IDs.
- Type: boolean (details)
- List the last 50 contributions by user Example.
- api.php?action=query&list=allrevisions&arvuser=Example&arvlimit=50 [open in sandbox]
- List the first 50 revisions in any namespace.
- api.php?action=query&list=allrevisions&arvdir=newer&arvlimit=50 [open in sandbox]
list=alltransclusions (at)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all transclusions (pages embedded using {{x}}), including non-existing.
- atcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- atfrom
The title of the transclusion to start enumerating from.
- atto
The title of the transclusion to stop enumerating at.
- atprefix
Search for all transcluded titles that begin with this value.
- atunique
Only show distinct transcluded titles. Cannot be used with atprop=ids.
When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- atprop
Which pieces of information to include:
- ids
- Adds the page ID of the transcluding page (cannot be used with atunique).
- title
- Adds the title of the transclusion.
- Values (separate with | or alternative): ids, title
- Default: title
- atnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Default: 10
- atlimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- atdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List transcluded titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=alltransclusions&atfrom=B&atprop=ids|title [open in sandbox]
- List unique transcluded titles.
- api.php?action=query&list=alltransclusions&atunique=&atfrom=B [open in sandbox]
- Gets all transcluded titles, marking the missing ones.
- api.php?action=query&generator=alltransclusions&gatunique=&gatfrom=B [open in sandbox]
- Gets pages containing the transclusions.
- api.php?action=query&generator=alltransclusions&gatfrom=B [open in sandbox]
list=allusers (au)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all registered users.
- aufrom
The username to start enumerating from.
- auto
The username to stop enumerating at.
- auprefix
Search for all users that begin with this value.
- audir
Direction to sort in.
- One of the following values: ascending, descending
- Default: ascending
- augroup
Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- auexcludegroup
Exclude users in the given groups.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- aurights
Only include users with the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, badcaptcha, badoath, badoath-long, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changeemail, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, checkuser-userinfo, collectionsaveascommunitypage, collectionsaveasuserpage, confirmemail, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, disableoath, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, growthexperiments-apiqueryimagesuggestiondata, growthexperimentsuserimpacthandler, growthmentordashboardupdatedata, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-ip-lookup, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, linkpurge, mailpassword, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, pagetriage-mark-action, pagetriage-tagging-action, patrol, patrolmarks, post-hcaptcha-token, protect, purge, read, recover-2fa, renameuser, renameuser-global, renderfile, renderfile-nonstandard, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, stashbasehtml, stashedit, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, thanks-notification, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortcode, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, verify-2fa, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed, wikimediaevents-hcaptcha-diff-logging
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- auprop
Which pieces of information to include:
- blockinfo
- Adds the information about a current block on the user.
- groups
- Lists groups that the user is in. This uses more server resources and may return fewer results than the limit.
- implicitgroups
- Lists all the groups the user is automatically in.
- rights
- Lists rights that the user has.
- editcount
- Adds the edit count of the user.
- registration
- Adds the timestamp of when the user registered if available (may be blank).
- centralids
- Adds the central IDs and attachment status for the user.
- tempexpired
- Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
- Values (separate with | or alternative): blockinfo, centralids, editcount, groups, implicitgroups, registration, rights, tempexpired
- aulimit
How many total usernames to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- auwitheditsonly
Only list users who have made edits.
- Type: boolean (details)
- auactiveusers
Only list users active in the last 30 days.
- Type: boolean (details)
- auattachedwiki
With auprop=centralids, also indicate whether the user is attached with the wiki identified by this ID.
- auexcludenamed
Exclude users of named accounts.
- Type: boolean (details)
- auexcludetemp
Exclude users of temporary accounts.
- Type: boolean (details)
- List users starting at Y.
- api.php?action=query&list=allusers&aufrom=Y [open in sandbox]
list=automatictranslationdenselanguages
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Fetch the list of sitelinks for the article that corresponds to a given Wikidata ID, ordered by article size.
- qid
The Wikidata ID.
- This parameter is required.
- section-titles
A boolean value indicating whether the section titles should be included in the response.
- Type: boolean (details)
- limit
The maximum number of sitelinks to fetch.
- Type: integer
- Default: 15
- Fetch the list of sitelinks for the 'Moon' article in all available languages, sorted by article size.
- api.php?action=query&list=automatictranslationdenselanguages&qid=Q405&limit=15 [open in sandbox]
- Fetch the list of sitelinks for the 'Moon' article, including the section titles, in all available languages, sorted by article size.
- api.php?action=query&list=automatictranslationdenselanguages&qid=Q405§ion-titles=true [open in sandbox]
list=backlinks (bl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given page.
- bltitle
Title to search. Cannot be used together with blpageid.
- blpageid
Page ID to search. Cannot be used together with bltitle.
- Type: integer
- blcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- blnamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- bldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- blfilterredir
How to filter for redirects. If set to nonredirects when blredirect is enabled, this is only applied to the second level.
- One of the following values: all, nonredirects, redirects
- Default: all
- bllimit
How many total pages to return. If blredirect is enabled, the limit applies to each level separately (which means up to 2 * bllimit results may be returned).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- blredirect
If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.
- Type: boolean (details)
- Show links to Main Page.
- api.php?action=query&list=backlinks&bltitle=Main%20Page [open in sandbox]
- Get information about pages linking to Main Page.
- api.php?action=query&generator=backlinks&gbltitle=Main%20Page&prop=info [open in sandbox]
list=betafeatures (bf)
- This module requires read rights.
- Source: BetaFeatures
- License: GPL-2.0-or-later
List all BetaFeatures
- bfcounts
Whether to fetch how many users have enabled a certain preference.
- Get all available beta features and show how many users have enabled them
- api.php?action=query&list=betafeatures&bfcounts= [open in sandbox]
list=blocks (bk)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all blocked users and IP addresses.
- bkstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- bkend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- bkdir
In which direction to enumerate:
- newer
- List oldest first. Note: bkstart has to be before bkend.
- older
- List newest first (default). Note: bkstart has to be later than bkend.
- One of the following values: newer, older
- Default: older
- bkids
List of block IDs to list (optional).
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bkusers
List of users to search for (optional).
- Type: list of users, by any of username, IP, Temporary user and IP range
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bkip
Get all blocks applying to this IP address or CIDR range, including range blocks.
Cannot be used together with bkusers. CIDR ranges broader than IPv4/16 or IPv6/19 are not accepted.
- bklimit
The maximum number of blocks to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- bkprop
Which properties to get:
- id
- Adds the ID of the block.
- user
- Adds the username of the blocked user.
- userid
- Adds the user ID of the blocked user.
- by
- Adds the username of the blocking user.
- byid
- Adds the user ID of the blocking user.
- timestamp
- Adds the timestamp of when the block was given.
- expiry
- Adds the timestamp of when the block expires.
- reason
- Adds the reason given for the block.
- parsedreason
- Adds the parsed reason given for the block.
- range
- Adds the range of IP addresses affected by the block.
- flags
- Tags the ban with (autoblock, anononly, etc.).
- restrictions
- Adds the partial block restrictions if the block is not sitewide.
- Values (separate with | or alternative): by, byid, expiry, flags, id, parsedreason, range, reason, restrictions, timestamp, user, userid
- Default: id|user|by|timestamp|expiry|reason|flags
- bkshow
Show only items that meet these criteria.
For example, to see only indefinite blocks on IP addresses, set bkshow=ip|!temp.
- Values (separate with | or alternative): !account, !ip, !range, !temp, account, ip, range, temp
- bkcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List blocks.
- api.php?action=query&list=blocks [open in sandbox]
- List blocks of users Alice and Bob.
- api.php?action=query&list=blocks&bkusers=Alice|Bob [open in sandbox]
list=categorymembers (cm)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all pages in a given category.
- cmtitle
Which category to enumerate (required). Must include the Category: prefix. Cannot be used together with cmpageid.
- cmpageid
Page ID of the category to enumerate. Cannot be used together with cmtitle.
- Type: integer
- cmprop
Which pieces of information to include:
- ids
- Adds the page ID.
- title
- Adds the title and namespace ID of the page.
- sortkey
- Adds the sortkey used for sorting in the category (hexadecimal string).
- sortkeyprefix
- Adds the sortkey prefix used for sorting in the category (human-readable part of the sortkey).
- type
- Adds the type that the page has been categorised as (page, subcat or file).
- timestamp
- Adds the timestamp of when the page was included.
- Values (separate with | or alternative): ids, sortkey, sortkeyprefix, timestamp, title, type
- Default: ids|title
- cmnamespace
Only include pages in these namespaces. Note that cmtype=subcat or cmtype=file may be used instead of cmnamespace=14 or 6.
Note: Due to miser mode, using this may result in fewer than cmlimit results returned before continuing; in extreme cases, zero results may be returned.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- cmtype
Which type of category members to include. Ignored when cmsort=timestamp is set.
- Values (separate with | or alternative): file, page, subcat
- Default: page|subcat|file
- cmcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- cmlimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- cmsort
Property to sort by.
- One of the following values: sortkey, timestamp
- Default: sortkey
- cmdir
In which direction to sort.
- One of the following values: asc, ascending, desc, descending, newer, older
- Default: ascending
- cmstart
Timestamp to start listing from. Can only be used with cmsort=timestamp.
- Type: timestamp (allowed formats)
- cmend
Timestamp to end listing at. Can only be used with cmsort=timestamp.
- Type: timestamp (allowed formats)
- cmstarthexsortkey
Sortkey to start listing from, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.
- cmendhexsortkey
Sortkey to end listing at, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.
- cmstartsortkeyprefix
Sortkey prefix to start listing from. Can only be used with cmsort=sortkey. Overrides cmstarthexsortkey.
- cmendsortkeyprefix
Sortkey prefix to end listing before (not at; if this value occurs it will not be included!). Can only be used with cmsort=sortkey. Overrides cmendhexsortkey.
- cmstartsortkey
- Deprecated.
Use cmstarthexsortkey instead.
- cmendsortkey
- Deprecated.
Use cmendhexsortkey instead.
- Get first 10 pages in Category:Physics.
- api.php?action=query&list=categorymembers&cmtitle=Category:Physics [open in sandbox]
- Get page info about first 10 pages in Category:Physics.
- api.php?action=query&generator=categorymembers&gcmtitle=Category:Physics&prop=info [open in sandbox]
list=centralnoticeactivecampaigns (cnac)
- This module requires read rights.
- Source: CentralNotice
- License: GPL-2.0-or-later
Get a list of currently active campaigns with start and end dates and associated banners.
- cnacincludefuture
Include enabled future campaigns (as well as currently active campaigns).
- Type: boolean (details)
- Get a list of currently active campaigns with start and end dates and associated banners.
- api.php?action=query&list=centralnoticeactivecampaigns&format=json [open in sandbox]
list=centralnoticelogs
- This module requires read rights.
- Source: CentralNotice
- License: GPL-2.0-or-later
Get a log of campaign configuration changes.
- campaign
Campaign name (optional). Separate multiple values with a "|" (vertical bar).
- user
Username (optional).
- limit
Maximum rows to return (optional).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 50
- offset
Offset into result set (optional).
- Type: integer
- Default: 0
- start
Start time of range (optional).
- Type: timestamp (allowed formats)
- end
End time of range (optional).
- Type: timestamp (allowed formats)
list=checkuser (cu)
- This module is deprecated.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CheckUser
- License: GPL-2.0-or-later
This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
- curequest
Type of CheckUser request:
- userips
- Get IP address of target user.
- edits
- Deprecated. Get actions performed by target IP address or range.
- actions
- Get actions performed by target IP address or range.
- ipusers
- Get users from target IP address or range.
- This parameter is required.
- One of the following values: actions, ipusers, userips, edits
- cutarget
Username, IP address, or CIDR range to check.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user and IP range
- cureason
Reason to check.
- This parameter is required.
- Default: (empty)
- culimit
Limit of rows.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 500
- cutimecond
Time limit of user data (like "-2 weeks" or "2 weeks ago").
- Default: -2 weeks
- cuxff
Use XFF data instead of IP address.
- cutoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Get IP addresses for User:Example
- api.php?action=query&list=checkuser&curequest=userips&cutarget=Jimbo_Wales [open in sandbox]
- Get actions performed by 192.0.2.0/24
- api.php?action=query&list=checkuser&curequest=actions&cutarget=127.0.0.1/16&xff=1&cureason=Some_check [open in sandbox]
list=checkuserlog (cul)
- This module requires read rights.
- Source: CheckUser
- License: GPL-2.0-or-later
Get entries from the CheckUser log.
- culuser
Username of the CheckUser.
- cultarget
Checked user, IP address, or CIDR range.
- culreason
Reason given for the check.
- cullimit
Limit of rows.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- culdir
In which direction to enumerate:
- newer
- List oldest first. Note: culfrom has to be before culto.
- older
- List newest first (default). Note: culfrom has to be later than culto.
- One of the following values: newer, older
- Default: older
- culfrom
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- culto
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- culcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show checks of User:Example
- api.php?action=query&list=checkuserlog&culuser=Example&cullimit=25 [open in sandbox]
- Show checks of 192.0.2.0/24 after 2011-10-15T23:00:00Z
- api.php?action=query&list=checkuserlog&cultarget=192.0.2.0/24&culfrom=2011-10-15T23:00:00Z [open in sandbox]
list=codexicons
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get Codex icons
- names
Names of icons
- This parameter is required.
- Values (separate with | or alternative): cdxIconAdd, cdxIconAlert, cdxIconAlignCenter, cdxIconAlignLeft, cdxIconAlignRight, cdxIconAppearance, cdxIconArrowDown, cdxIconArrowNext, cdxIconArrowPrevious, cdxIconArrowUp, cdxIconArticle, cdxIconArticleAdd, cdxIconArticleCheck, cdxIconArticleDisambiguation, cdxIconArticleNotFound, cdxIconArticleRedirect, cdxIconArticleSearch, cdxIconArticles, cdxIconArticlesSearch, cdxIconAttachment, cdxIconBell, cdxIconBellOutline, cdxIconBigger, cdxIconBlock, cdxIconBold, cdxIconBook, cdxIconBookmark, cdxIconBookmarkList, cdxIconBookmarkOutline, cdxIconBright, cdxIconBrowser, cdxIconCalendar, cdxIconCamera, cdxIconCancel, cdxIconChart, cdxIconCheck, cdxIconCheckAll, cdxIconClear, cdxIconClock, cdxIconClose, cdxIconCode, cdxIconCollapse, cdxIconConfigure, cdxIconCopy, cdxIconCut, cdxIconDatabase, cdxIconDie, cdxIconDoubleChevronEnd, cdxIconDoubleChevronStart, cdxIconDownTriangle, cdxIconDownload, cdxIconDraggable, cdxIconEdit, cdxIconEditLock, cdxIconEditUndo, cdxIconEllipsis, cdxIconError, cdxIconExitFullscreen, cdxIconExpand, cdxIconEye, cdxIconEyeClosed, cdxIconFeedback, cdxIconFlag, cdxIconFolderPlaceholder, cdxIconFullscreen, cdxIconFunction, cdxIconFunctionArgument, cdxIconFunnel, cdxIconGlobe, cdxIconHalfBright, cdxIconHalfStar, cdxIconHand, cdxIconHeart, cdxIconHelp, cdxIconHelpNotice, cdxIconHieroglyph, cdxIconHighlight, cdxIconHistory, cdxIconHome, cdxIconImage, cdxIconImageAdd, cdxIconImageBroken, cdxIconImageGallery, cdxIconImageLayoutBasic, cdxIconImageLayoutFrame, cdxIconImageLayoutFrameless, cdxIconImageLayoutThumbnail, cdxIconImageLock, cdxIconIndent, cdxIconInfo, cdxIconInfoFilled, cdxIconInstance, cdxIconItalic, cdxIconJournal, cdxIconKey, cdxIconKeyboard, cdxIconLabFlask, cdxIconLanguage, cdxIconLargerText, cdxIconLayout, cdxIconLightbulb, cdxIconLink, cdxIconLinkExternal, cdxIconLinkSecure, cdxIconListBullet, cdxIconListNumbered, cdxIconLiteral, cdxIconLock, cdxIconLogIn, cdxIconLogOut, cdxIconLogoCC, cdxIconLogoCodex, cdxIconLogoMediaWiki, cdxIconLogoMetaWiki, cdxIconLogoWikibooks, cdxIconLogoWikidata, cdxIconLogoWikifunctions, cdxIconLogoWikimedia, cdxIconLogoWikimediaCommons, cdxIconLogoWikimediaDiscovery, cdxIconLogoWikinews, cdxIconLogoWikipedia, cdxIconLogoWikiquote, cdxIconLogoWikisource, cdxIconLogoWikispecies, cdxIconLogoWikiversity, cdxIconLogoWikivoyage, cdxIconLogoWiktionary, cdxIconMap, cdxIconMapPin, cdxIconMapPinAdd, cdxIconMapTrail, cdxIconMarkup, cdxIconMathematics, cdxIconMathematicsDisplayBlock, cdxIconMathematicsDisplayDefault, cdxIconMathematicsDisplayInline, cdxIconMenu, cdxIconMerge, cdxIconMessage, cdxIconMoon, cdxIconMove, cdxIconMoveFirst, cdxIconMoveLast, cdxIconMusicalScore, cdxIconNetwork, cdxIconNetworkOff, cdxIconNewWindow, cdxIconNewline, cdxIconNewspaper, cdxIconNext, cdxIconNoWikitext, cdxIconNotBright, cdxIconNotice, cdxIconOngoingConversation, cdxIconOutdent, cdxIconOutline, cdxIconPageSettings, cdxIconPalette, cdxIconPaste, cdxIconPause, cdxIconPlay, cdxIconPower, cdxIconPrevious, cdxIconPrinter, cdxIconPushPin, cdxIconPuzzle, cdxIconQrCode, cdxIconQuotes, cdxIconRecentChanges, cdxIconRedo, cdxIconReference, cdxIconReferenceExisting, cdxIconReferences, cdxIconReload, cdxIconRestore, cdxIconRobot, cdxIconSandbox, cdxIconSearch, cdxIconSearchCaseSensitive, cdxIconSearchDiacritics, cdxIconSearchRegularExpression, cdxIconSettings, cdxIconShare, cdxIconSignature, cdxIconSmaller, cdxIconSmallerText, cdxIconSortVertical, cdxIconSpecialCharacter, cdxIconSpecialPages, cdxIconSpeechBubble, cdxIconSpeechBubbleAdd, cdxIconSpeechBubbles, cdxIconStar, cdxIconStop, cdxIconStrikethrough, cdxIconSubscript, cdxIconSubtract, cdxIconSuccess, cdxIconSuperscript, cdxIconTable, cdxIconTableAddColumnAfter, cdxIconTableAddColumnBefore, cdxIconTableAddRowAfter, cdxIconTableAddRowBefore, cdxIconTableCaption, cdxIconTableMergeCells, cdxIconTableMoveColumnAfter, cdxIconTableMoveColumnBefore, cdxIconTableMoveRowAfter, cdxIconTableMoveRowBefore, cdxIconTag, cdxIconTemplateAdd, cdxIconTextDirLTR, cdxIconTextDirRTL, cdxIconTextFlow, cdxIconTextStyle, cdxIconTextSummary, cdxIconTrash, cdxIconTray, cdxIconUnBlock, cdxIconUnFlag, cdxIconUnLink, cdxIconUnLock, cdxIconUnStar, cdxIconUnderline, cdxIconUndo, cdxIconUpTriangle, cdxIconUpdate, cdxIconUpload, cdxIconUserActive, cdxIconUserAdd, cdxIconUserAnonymous, cdxIconUserAvatar, cdxIconUserAvatarOutline, cdxIconUserBlocked, cdxIconUserContributions, cdxIconUserGroup, cdxIconUserRights, cdxIconUserTalk, cdxIconUserTemporary, cdxIconUserTemporaryLocation, cdxIconViewCompact, cdxIconViewDetails, cdxIconVisionSimulator, cdxIconVolumeDown, cdxIconVolumeOff, cdxIconVolumeUp, cdxIconWatchlist, cdxIconWikitext, cdxIconWindow, cdxIconZoomIn, cdxIconZoomOut
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- To specify all values, use *.
- Get icons for cdxIconInfo and cdxIconTrash
- api.php?action=query&list=codexicons&names=cdxIconInfo|cdxIconTrash [open in sandbox]
list=contenttranslation
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Query Content Translation database for translations.
- translationid
Translation ID.
- from
The source language code.
- to
The target language code.
- sourcetitle
The title of the source page.
- sourcesectiontitle
The title of the source section (optional).
- limit
The maximum number of translations to fetch.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 100
- offset
Offset into result set (optional).
- type
State of the translation.
- One of the following values: draft, published
- Default: draft
- usecase
The usecase for which the translations are being fetched (optional).
- One of the following values: desktop-editor-draft, translation-corpora-units, unified-dashboard
- Get translations started by the current user.
- api.php?action=query&list=contenttranslation [open in sandbox]
- Get translations draft by ID.
- api.php?action=query&list=contenttranslation&translationid=94 [open in sandbox]
- Find any translation for the given title between given language pair
- api.php?action=query&list=contenttranslation&from=en&to=es&sourcetitle=Hibiscus [open in sandbox]
list=contenttranslationcorpora
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get the section-aligned parallel text for a given translation. See also list=cxpublishedtranslations. Dumps are provided in different formats for high volume access.
- translationid
ID of the translation.
- This parameter is required.
- Type: integer
- striphtml
Whether to strip all HTML tags to return plaintext.
- Type: boolean (details)
- types
By default you will get all three of following if available: source text, machine translation and the postedited translation by the user. This parameter allows you not return some of these types.
- Values (separate with | or alternative): mt, source, user
- Default: source|mt|user
list=contenttranslationfavoritesuggestions
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get user's favorite suggestions for Content Translation.
- limit
The maximum number of translation suggestions to fetch.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 100
- offset
Offset for paginated results.
- Fetch the favorite suggestions for the current user
- api.php?action=query&list=contenttranslationfavoritesuggestions [open in sandbox]
list=cxpublishedtranslations
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Fetch all published translations information.
- from
The source language code.
- This parameter is required.
- to
The target language code.
- This parameter is required.
- limit
The maximum number of translations to fetch.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 500
- offset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- Fetch all published translations, translated from English to Spanish
- api.php?action=query&list=cxpublishedtranslations&from=en&to=es [open in sandbox]
list=cxtranslatorstats
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Fetch the translation statistics for the given user.
- translator
The translator's username. This parameter is optional. If not passed, the currently logged-in user will be used.
- Fetch the translation statistics for the given user.
- api.php?action=query&list=cxtranslatorstats&translator=TranslatorName [open in sandbox]
list=deletedrevs (dr)
- This module is deprecated.
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List deleted revisions.
Operates in three modes:
- List deleted revisions for the given titles, sorted by timestamp.
- List deleted contributions for the given user, sorted by timestamp (no titles specified).
- List all deleted revisions in the given namespace, sorted by title and timestamp (no titles specified, druser not set).
Certain parameters only apply to some modes and are ignored in others.
- drstart
The timestamp to start enumerating from.
- Modes: 1, 2
- Type: timestamp (allowed formats)
- drend
The timestamp to stop enumerating at.
- Modes: 1, 2
- Type: timestamp (allowed formats)
- drdir
In which direction to enumerate:
- newer
- List oldest first. Note: drstart has to be before drend.
- older
- List newest first (default). Note: drstart has to be later than drend.
- Modes: 1, 3
- One of the following values: newer, older
- Default: older
- drfrom
Start listing at this title.
- Mode: 3
- drto
Stop listing at this title.
- Mode: 3
- drprefix
Search for all page titles that begin with this value.
- Mode: 3
- drunique
List only one revision for each page.
- Mode: 3
- Type: boolean (details)
- drnamespace
Only list pages in this namespace.
- Mode: 3
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Default: 0
- drtag
Only list revisions tagged with this tag.
- druser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drprop
Which properties to get:
- revid
- Adds the revision ID of the deleted revision.
- parentid
- Adds the revision ID of the previous revision to the page.
- user
- Adds the user who made the revision.
- userid
- Adds the ID of the user who made the revision.
- comment
- Adds the comment of the revision.
- parsedcomment
- Adds the parsed comment of the revision.
- minor
- Tags if the revision is minor.
- len
- Adds the length (bytes) of the revision.
- sha1
- Adds the SHA-1 (base 16) of the revision.
- content
- Adds the content of the revision. For performance reasons, if this option is used, drlimit is enforced to 50.
- token
- Deprecated. Gives the edit token.
- tags
- Tags for the revision.
- Values (separate with | or alternative): comment, content, len, minor, parentid, parsedcomment, revid, sha1, tags, user, userid, token
- Default: user|comment
- drlimit
The maximum amount of revisions to list. If drprop=content is used, the limit is 50.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- drcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the last deleted revisions of the pages Main Page and Talk:Main Page, with content (mode 1).
- api.php?action=query&list=deletedrevs&titles=Main%20Page|Talk%3AMain%20Page&drprop=user|comment|content [open in sandbox]
- List the last 50 deleted contributions by Bob (mode 2).
- api.php?action=query&list=deletedrevs&druser=Bob&drlimit=50 [open in sandbox]
- List the first 50 deleted revisions in the main namespace (mode 3).
- api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50 [open in sandbox]
- List the first 50 deleted pages in the Talk namespace (mode 3).
- api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50&drnamespace=1&drunique= [open in sandbox]
list=embeddedin (ei)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that embed (transclude) the given title.
- eititle
Title to search. Cannot be used together with eipageid.
- eipageid
Page ID to search. Cannot be used together with eititle.
- Type: integer
- eicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- einamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- eidir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- eifilterredir
How to filter for redirects.
- One of the following values: all, nonredirects, redirects
- Default: all
- eilimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Show pages transcluding Template:Stub.
- api.php?action=query&list=embeddedin&eititle=Template:Stub [open in sandbox]
- Get information about pages transcluding Template:Stub.
- api.php?action=query&generator=embeddedin&geititle=Template:Stub&prop=info [open in sandbox]
list=exturlusage (eu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate pages that contain a given URL.
- euprop
Which pieces of information to include:
- ids
- Adds the ID of page.
- title
- Adds the title and namespace ID of the page.
- url
- Adds the URL used in the page.
- Values (separate with | or alternative): ids, title, url
- Default: ids|title|url
- eucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- euprotocol
Protocol of the URL. If empty and euquery is set, the protocol is http and https. Leave both this and euquery empty to list all external links.
- One of the following values: Can be empty, or bitcoin, commonsfinder, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
- Default: (empty)
- euquery
Search string without protocol. See Special:LinkSearch. Leave empty to list all external links.
- eunamespace
The page namespaces to enumerate.
Note: Due to miser mode, using this may result in fewer than eulimit results returned before continuing; in extreme cases, zero results may be returned.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- eulimit
How many pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- euexpandurl
- Deprecated.
Expand protocol-relative URLs with the canonical protocol.
- Type: boolean (details)
list=filearchive (fa)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all deleted files sequentially.
- fafrom
The image title to start enumerating from.
- fato
The image title to stop enumerating at.
- faprefix
Search for all image titles that begin with this value.
- fadir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- fasha1
SHA1 hash of image. Overrides fasha1base36.
- fasha1base36
SHA1 hash of image in base 36 (used in MediaWiki).
- faprop
Which image information to get:
- sha1
- Adds SHA-1 hash for the image.
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds user who uploaded the image version.
- size
- Adds the size of the image in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- description
- Adds description of the image version.
- parseddescription
- Parse the description of the version.
- mime
- Adds MIME of the image.
- mediatype
- Adds the media type of the image.
- metadata
- Lists Exif metadata for the version of the image.
- bitdepth
- Adds the bit depth of the version.
- archivename
- Adds the filename of the archive version for non-latest versions.
- Values (separate with | or alternative): archivename, bitdepth, description, dimensions, mediatype, metadata, mime, parseddescription, sha1, size, timestamp, user
- Default: timestamp
- falimit
How many images to return in total.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- facontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show a list of all deleted files.
- api.php?action=query&list=filearchive [open in sandbox]
list=gadgetcategories (gc)
- This module requires read rights.
- Source: Gadgets
- License: GPL-2.0-or-later
Returns a list of gadget sections.
- gcprop
What gadget section information to get:
- name
- Internal section name.
- title
- Section title.
- members
- Number of gadgets in section.
- Values (separate with | or alternative): members, name, title
- Default: name
- gcnames
Names of sections to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get a list of existing gadget sections
- api.php?action=query&list=gadgetcategories [open in sandbox]
- Get all information about sections named "foo" and "bar"
- api.php?action=query&list=gadgetcategories&gcnames=foo|bar&gcprop=name|title|members [open in sandbox]
list=gadgets (ga)
- This module requires read rights.
- Source: Gadgets
- License: GPL-2.0-or-later
Returns a list of gadgets used on this wiki.
- gaprop
What gadget information to get:
- id
- Internal gadget ID.
- metadata
- The gadget metadata.
- desc
- Gadget description transformed into HTML (can be slow, use only if really needed).
- Values (separate with | or alternative): desc, id, metadata
- Default: id|metadata
- gacategories
Gadgets from what categories to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- gaids
IDs of gadgets to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- gaallowedonly
List only gadgets allowed to current user.
- Type: boolean (details)
- gaenabledonly
List only gadgets enabled by current user.
- Type: boolean (details)
- Get a list of gadgets along with their descriptions
- api.php?action=query&list=gadgets&gaprop=id|desc [open in sandbox]
- Get a list of gadgets with all possible properties
- api.php?action=query&list=gadgets&gaprop=id|metadata|desc [open in sandbox]
- Get a list of gadgets belonging to category "foo"
- api.php?action=query&list=gadgets&gacategories=foo [open in sandbox]
- Get information about gadgets "foo" and "bar"
- api.php?action=query&list=gadgets&gaids=foo|bar&gaprop=id|desc|metadata [open in sandbox]
- Get a list of gadgets enabled by current user
- api.php?action=query&list=gadgets&gaenabledonly [open in sandbox]
list=geosearch (gs)
- This module requires read rights.
- This module can be used as a generator.
- Source: GeoData
- License: WTFPL
Returns pages having coordinates that are located in a certain area.
- gscoord
Coordinate around which to search.
Format: Latitude and longitude separated by pipe (|).
- gspage
Title of page around which to search.
- gsbbox
Bounding box to search in: pipe (|) separated coordinates of top left and bottom right corners.
- gsradius
Search radius in meters.
- Type: integer
- The value must be between 10 and 10,000.
- Default: 500
- gsmaxdim
Restrict search to objects no larger than this, in meters.
- Type: integer
- gssort
Set the sort order of returned results.
- distance
- Rank pages by their distance to the center.
- relevance
- Rank pages by their relevance according to CirrusSearch, similar to how Special:Search does it. Currently only supported on wikis that use the ElasticSearch backend, see mw:Extension:GeoData#Search backends.
- One of the following values: distance, relevance
- Default: distance
- gslimit
Maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- gsglobe
Globe to search on. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.
- One of the following values: earth, mars, moon, venus
- Default: earth
- gsnamespace
Namespaces to search.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: 0
- gsprop
Which additional coordinate properties to return. (Properties that are always returned: lat, lon, and either primary or secondary as a boolean flag.)
- type
- Type of the object the coordinates point to. See mw:Special:MyLanguage/Extension:GeoData#Usage for details.
- name
- Name of the object.
- dim
- Approximate size of the object in meters.
- country
- ISO 3166-1 alpha-2 country code (e.g. US or RU).
- region
- ISO 3166-2 region code (the part of the ISO 3166-2 code after the dash; e.g. FL or MOS).
- globe
- Which terrestrial body the coordinates are relative to (e.g. moon or pluto). Defaults to Earth. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.
- Values (separate with | or alternative): country, dim, globe, name, region, type
- Default: globe
- gsprimary
Which kind of coordinates to return.
- primary
- The location of the subject of the article. There is at most one primary coordinate per title.
- secondary
- The location of some object that's mentioned in the article. Any number of secondary coordinates can be associated with a title.
- all
- Return both primary and secondary coordinates.
- One of the following values: all, primary, secondary
- Default: primary
- gsdebug
Whether debug information should be returned.
- Type: boolean (details)
- Search around the point with coordinates 37° 47′ 13.1″ N, 122° 23′ 58.84″ W
- api.php?action=query&list=geosearch&gsradius=10000&gscoord=37.786971|-122.399677 [open in sandbox]
- Search in a bounding box
- api.php?action=query&list=geosearch&gsbbox=37.8|-122.3|37.7|-122.4 [open in sandbox]
list=globalallusers (agu)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Enumerate all global users.
- agufrom
The username to start enumerating from.
- aguto
The username to stop enumerating at.
- aguprefix
Search for all users that begin with this value.
- agudir
Direction to sort in.
- One of the following values: ascending, descending
- Default: ascending
- agugroup
Limit users to given global groups.
- Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
- aguexcludegroup
Exclude users in given global groups.
- Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
- aguprop
What pieces of information to include:
- lockinfo
- Whether the user account is locked.
- groups
- Lists global groups that the user is in. This uses more server resources and may return fewer results than the limit.
- existslocally
- Adds the information if the user exists locally.
- Values (separate with | or alternative): existslocally, groups, lockinfo
- agulimit
How many total usernames to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- aguexcludenamed
Exclude users of named accounts.
- Type: boolean (details)
- aguexcludetemp
Exclude users of temporary accounts.
- Type: boolean (details)
- List global users
- api.php?action=query&list=globalallusers [open in sandbox]
- Show some information for global users starting from "ABC"
- api.php?action=query&list=globalallusers&agufrom=ABC&aguprop=lockinfo|groups|existslocally [open in sandbox]
list=globalblocks (bg)
- This module requires read rights.
- Source: GlobalBlocking
- License: GPL-2.0-or-later
List all globally blocked IP addresses.
- bgstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- bgend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- bgdir
In which direction to enumerate:
- One of the following values: newer, older
- Default: older
- bgids
Pipe-separated list of block IDs to list.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bgaddresses
- Deprecated.
Pipe-separated list of IP addresses to search for.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bgtargets
Pipe-separated list of usernames, IP addresses, or IP ranges to search for. To search for IP blocks inside a given range, use bgip instead.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bgip
Get all blocks applying to this IP address or CIDR range, including range blocks. Cannot be used together with bgaddresses or bgtargets. CIDR ranges broader than /16 are not accepted.
- bglimit
The maximum amount of blocks to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- bgprop
Which properties to get.
- id
- Adds the ID of the global block.
- address
- Deprecated. Adds the target of the global block. This is deprecated and has been replaced by the 'target' prop.
- target
- Adds the target of the global block.
- by
- Adds the username of the blocking user, along with the wiki where they performed the global block.
- timestamp
- Adds the timestamp of when the global block was given.
- expiry
- Adds the timestamp of when the global block expires.
- reason
- Adds the reason given for the global block.
- range
- Adds the range of IP addresses affected by the global block (not included if the block does not target IP addresses).
- Values (separate with | or alternative): by, expiry, id, range, reason, target, timestamp, address
- Default: id|target|by|timestamp|expiry|reason
- List all global blocks
- api.php?action=query&list=globalblocks [open in sandbox]
- List global blocks applying to IP address 192.0.2.18
- api.php?action=query&list=globalblocks&bgip=192.0.2.18 [open in sandbox]
list=globalgroups (ggp)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Enumerate all global groups.
- ggpprop
What pieces of information to include.
- Values (separate with | or alternative): rights
- List global groups
- api.php?action=query&list=globalgroups [open in sandbox]
- Show global groups with the rights they grant
- api.php?action=query&list=globalgroups&ggpprop=rights [open in sandbox]
list=globalusers (gus)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Get information about a list of global users.
- gusprop
Which pieces of information to include:
- locked
- Adds information on whether the user is globally locked.
- editcount
- Adds the user's global edit count.
- registration
- Adds the user's global account registration timestamp.
- localinfo
- Adds the user's local account information.
- groups
- Lists all the global groups each user belongs to.
- groupmemberships
- Lists global groups that each user has been explicitly assigned to, including the expiry date of each group membership.
- rights
- Lists all the global rights each user has.
- Values (separate with | or alternative): editcount, groupmemberships, groups, localinfo, locked, registration, rights
- gususers
A list of global users to obtain information for. Cannot be used together with guscentralids.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- guscentralids
A list of central user IDs to obtain information for. Cannot be used together with gususers.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- guslocalgroups
When listing groups or rights, only include those that apply to the current wiki.
- Type: boolean (details)
- Return information for the user Example.
- api.php?action=query&list=globalusers&gususers=Example [open in sandbox]
- Return information for the user with central ID 1.
- api.php?action=query&list=globalusers&guscentralids=1 [open in sandbox]
list=growthmentorlist
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
List all the mentors
list=growthmentormentee
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Get all mentees assigned to a given mentor
- gemmmentor
Mentor to query mentees for
- This parameter is required.
- Type: user, by any of username and user ID (e.g. "#12345")
list=growthstarredmentees
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Get list of mentees starred by the currently logged in mentor
list=growthtasks (gt)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module can be used as a generator.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Get task recommendations suitable for newcomers.
Suggests a set of articles which have some outstanding issues easy enough for a new editor to tackle.
- gttasktypes
Task types to limit results to. Leave empty to receive all suggestions.
- copyedit
- Copyedit
- expand
- Expand short articles
- links
- Add links between articles
- references
- Find references
- update
- Update articles
- link-recommendation
- Add links between articles
- revise-tone
- Revise tone
- Values (separate with | or alternative): copyedit, expand, link-recommendation, links, references, revise-tone, update
- Default: (empty)
- gttopics
Article topics to prefer in task suggestions.
- architecture
- Architecture
- art
- Art
- comics-and-anime
- Comics and anime
- entertainment
- Entertainment
- fashion
- Fashion
- literature
- Literature
- music
- Music
- performing-arts
- Performing arts
- sports
- Sports
- tv-and-film
- TV and film
- video-games
- Video games
- biography
- Biography (all)
- women
- Biography (women)
- business-and-economics
- Business and economics
- education
- Education
- food-and-drink
- Food and drink
- history
- History
- military-and-warfare
- Military and warfare
- philosophy-and-religion
- Philosophy and religion
- politics-and-government
- Politics and government
- society
- Society
- transportation
- Transportation
- biology
- Biology
- chemistry
- Chemistry
- computers-and-internet
- Computers and internet
- earth-and-environment
- Earth and environment
- engineering
- Engineering
- general-science
- General science
- mathematics
- Mathematics
- medicine-and-health
- Medicine and health
- physics
- Physics
- technology
- Technology
- africa
- Africa
- asia
- Asia
- central-america
- Central America
- europe
- Europe
- north-america
- North America
- oceania
- Oceania
- south-america
- South America
- Values (separate with | or alternative): africa, architecture, art, asia, biography, biology, business-and-economics, central-america, chemistry, comics-and-anime, computers-and-internet, earth-and-environment, education, engineering, entertainment, europe, fashion, food-and-drink, general-science, history, literature, mathematics, medicine-and-health, military-and-warfare, music, north-america, oceania, performing-arts, philosophy-and-religion, physics, politics-and-government, society, south-america, sports, technology, transportation, tv-and-film, video-games, women
- Default: (empty)
- gttopicsmode
Matching mode for topics.
- One of the following values: AND, OR
- gtlimit
Maximum number of task suggestions to return.
- Type: integer or max
- The value must be between 0 and 250.
- gtoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- The value must be no less than 1.
- gtdebug
Add debug data to the output.
- Type: boolean (details)
- gtexcludepageids
Page IDs to exclude from the query.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 1,000.
- Get task recommendations for copy-editing-type tasks for the current user.
- api.php?action=query&list=growthtasks>tasktypes=copyedit [open in sandbox]
- Get task recommendations for the current user, with extended information about the pages.
- api.php?action=query&generator=growthtasks&ggtlimit=max&prop=info|revision [open in sandbox]
list=imageusage (iu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that use the given image title.
- iutitle
Title to search. Cannot be used together with iupageid.
- iupageid
Page ID to search. Cannot be used together with iutitle.
- Type: integer
- iucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iunamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- iudir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- iufilterredir
How to filter for redirects. If set to nonredirects when iuredirect is enabled, this is only applied to the second level.
- One of the following values: all, nonredirects, redirects
- Default: all
- iulimit
How many total pages to return. If iuredirect is enabled, the limit applies to each level separately (which means up to 2 * iulimit results may be returned).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iuredirect
If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.
- Type: boolean (details)
- Show pages using File:Albert Einstein Head.jpg.
- api.php?action=query&list=imageusage&iutitle=File:Albert%20Einstein%20Head.jpg [open in sandbox]
- Get information about pages using File:Albert Einstein Head.jpg.
- api.php?action=query&generator=imageusage&giutitle=File:Albert%20Einstein%20Head.jpg&prop=info [open in sandbox]
list=iwbacklinks (iwbl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given interwiki link.
Can be used to find all links with a prefix, or all links to a title (with a given prefix). Using neither parameter is effectively "all interwiki links".
- iwblprefix
Prefix for the interwiki.
- iwbltitle
Interwiki link to search for. Must be used with iwblblprefix.
- iwblcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iwbllimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iwblprop
Which properties to get:
- iwprefix
- Adds the prefix of the interwiki.
- iwtitle
- Adds the title of the interwiki.
- Values (separate with | or alternative): iwprefix, iwtitle
- Default: (empty)
- iwbldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get pages linking to wikibooks:Test.
- api.php?action=query&list=iwbacklinks&iwbltitle=Test&iwblprefix=wikibooks [open in sandbox]
- Get information about pages linking to wikibooks:Test.
- api.php?action=query&generator=iwbacklinks&giwbltitle=Test&giwblprefix=wikibooks&prop=info [open in sandbox]
list=langbacklinks (lbl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given language link.
Can be used to find all links with a language code, or all links to a title (with a given language). Using neither parameter is effectively "all language links".
Note that this may not consider language links added by extensions.
- lbllang
Language for the language link.
- lbltitle
Language link to search for. Must be used with lbllang.
- lblcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- lbllimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lblprop
Which properties to get:
- lllang
- Adds the language code of the language link.
- lltitle
- Adds the title of the language link.
- Values (separate with | or alternative): lllang, lltitle
- Default: (empty)
- lbldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get pages linking to fr:Test.
- api.php?action=query&list=langbacklinks&lbltitle=Test&lbllang=fr [open in sandbox]
- Get information about pages linking to fr:Test.
- api.php?action=query&generator=langbacklinks&glbltitle=Test&glbllang=fr&prop=info [open in sandbox]
list=linterrors (lnt)
- This module requires read rights.
- Source: Linter
- License: GPL-2.0-or-later
Get a list of lint errors
- lntcategories
Categories of lint errors
- Values (separate with | or alternative): bogus-image-options, deletable-table-tag, duplicate-ids, empty-heading, fostered, fostered-transparent, html5-misnesting, large-tables, misc-tidy-replacement-issues, misnested-tag, missing-end-tag, missing-end-tag-in-heading, multi-colon-escape, multiline-html-table-in-list, multiple-unclosed-formatting-tags, night-mode-unaware-background-color, obsolete-tag, pwrap-bug-workaround, self-closed-tag, stripped-tag, template-arg-in-extension-tag, tidy-font-bug, tidy-whitespace-bug, unclosed-quotes-in-heading, wikilink-in-extlink
- Default: deletable-table-tag|duplicate-ids|html5-misnesting|misc-tidy-replacement-issues|multiline-html-table-in-list|multiple-unclosed-formatting-tags|pwrap-bug-workaround|self-closed-tag|template-arg-in-extension-tag|tidy-font-bug|tidy-whitespace-bug|unclosed-quotes-in-heading|bogus-image-options|fostered|misnested-tag|multi-colon-escape|wikilink-in-extlink|empty-heading|missing-end-tag|missing-end-tag-in-heading|night-mode-unaware-background-color|obsolete-tag|stripped-tag
- lntlimit
Number of results to query
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lntnamespace
Only include lint errors from the specified namespaces
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- lntpageid
Only include lint errors from the specified page IDs
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- lnttitle
Only include lint errors from the specified page title
- lntfrom
Lint ID to start querying from
- Type: integer
- Get all lint errors of the obsolete-tag category
- api.php?action=query&list=linterrors&lntcategories=obsolete-tag [open in sandbox]
list=logevents (le)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get events from logs.
- leprop
Which properties to get:
- ids
- Adds the ID of the log event.
- title
- Adds the title of the page for the log event.
- type
- Adds the type of log event.
- user
- Adds the user responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds the user ID who was responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
- timestamp
- Adds the timestamp for the log event.
- comment
- Adds the comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
- details
- Lists additional details about the log event. If the log event has been revision deleted, an actionhidden property will be returned.
- tags
- Lists tags for the log event.
- Values (separate with | or alternative): comment, details, ids, parsedcomment, tags, timestamp, title, type, user, userid
- Default: ids|title|type|user|timestamp|comment|details
- letype
Filter log entries to only this type.
- One of the following values: Can be empty, or abusefilter, abusefilter-protected-vars, abusefilterblockeddomainhit, abusefilterprivatedetails, block, checkuser-temporary-account, contentmodel, create, delete, gblblock, gblrename, gblrights, globalauth, growthexperiments, import, interwiki, ipinfo, managetags, massmessage, merge, move, newusers, oath, pagetriage-copyvio, pagetriage-curation, patrol, protect, renameuser, review, rights, spamblacklist, stable, suppress, tag, thanks, timedmediahandler, titleblacklist, upload, urlshortener, usermerge
- leaction
Filter log actions to only this action. Overrides letype. In the list of possible values, values with the asterisk wildcard such as action/* can have different strings after the slash (/).
- One of the following values: abusefilter-protected-vars/*, abusefilter/create, abusefilter/hit, abusefilter/modify, abusefilterblockeddomainhit/*, abusefilterprivatedetails/access, block/block, block/reblock, block/unblock, checkuser-private-event/*, checkuser-temporary-account/*, contentmodel/change, contentmodel/new, create/create, delete/delete, delete/delete_redir, delete/delete_redir2, delete/event, delete/restore, delete/revision, emailauth/*, gblblock/*, gblblock/gunblock, gblrename/merge, gblrename/promote, gblrename/rename, gblrights/deleteset, gblrights/groupperms, gblrights/groupprms2, gblrights/groupprms3, gblrights/grouprename, gblrights/newset, gblrights/setchange, gblrights/setnewtype, gblrights/setrename, gblrights/usergroups, globalauth/delete, globalauth/hide, globalauth/lock, globalauth/lockandhid, globalauth/setstatus, globalauth/unhide, globalauth/unlock, growthexperiments/addimage, growthexperiments/addlink, growthexperiments/addsectionimage, growthexperiments/claimmentee, growthexperiments/claimmentee-no-previous-mentor, growthexperiments/setmentor, growthexperiments/setmentor-no-previous-mentor, import/interwiki, import/upload, interwiki/iw_add, interwiki/iw_delete, interwiki/iw_edit, ipinfo/*, managetags/activate, managetags/create, managetags/deactivate, managetags/delete, massmessage/*, massmessage/failure, massmessage/send, massmessage/skipbadns, massmessage/skipnouser, massmessage/skipoptout, merge/merge, merge/merge-into, move/move, move/move_redir, newusers/autocreate, newusers/byemail, newusers/create, newusers/create2, newusers/forcecreatelocal, newusers/newusers, oath/*, pagetriage-copyvio/delete, pagetriage-copyvio/insert, pagetriage-curation/delete, pagetriage-curation/enqueue, pagetriage-curation/reviewed, pagetriage-curation/reviewed-article, pagetriage-curation/reviewed-redirect, pagetriage-curation/tag, pagetriage-curation/unreviewed, pagetriage-curation/unreviewed-article, pagetriage-curation/unreviewed-redirect, patrol/autopatrol, patrol/patrol, protect/modify, protect/move_prot, protect/protect, protect/unprotect, renameuser/renameuser, review/*, rights/autopromote, rights/blockautopromote, rights/erevoke, rights/restoreautopromote, rights/rights, spamblacklist/*, stable/config, stable/modify, stable/move_stable, stable/reset, suppress/block, suppress/cadelete, suppress/delete, suppress/event, suppress/hide-afl, suppress/reblock, suppress/revision, suppress/setstatus, suppress/unhide-afl, tag/update, thanks/*, timedmediahandler/resettranscode, titleblacklist/*, upload/overwrite, upload/revert, upload/upload, urlshortener/*, usermerge/*
- lestart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- leend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- ledir
In which direction to enumerate:
- newer
- List oldest first. Note: lestart has to be before leend.
- older
- List newest first (default). Note: lestart has to be later than leend.
- One of the following values: newer, older
- Default: older
- leids
Filter entries to those matching the given log ID(s).
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- leuser
Filter entries to those made by the given user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- letitle
Filter entries to those related to a page.
- lenamespace
Filter entries to those in the given namespace.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- leprefix
Disabled due to miser mode.
- letag
Only list event entries tagged with this tag.
- lelimit
How many total event entries to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lecontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List recent log events.
- api.php?action=query&list=logevents [open in sandbox]
list=mostviewed (pvim)
- This module requires read rights.
- This module can be used as a generator.
- Source: PageViewInfo
- License: GPL-3.0-or-later
Lists the most viewed pages (based on last day's pageview count).
- pvimmetric
The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)
- pageviews
- Plain pageviews.
- One of the following values: pageviews
- Default: pageviews
- pvimlimit
The number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pvimoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- List the top 10 pages.
- api.php?action=query&list=mostviewed [open in sandbox]
- Show pageview data for each of the top 10 pages.
- api.php?action=query&generator=mostviewed&prop=pageviews [open in sandbox]
list=mystashedfiles (msf)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a list of files in the current user's upload stash.
- msfprop
Which properties to fetch for the files.
- size
- Fetch the file size and image dimensions.
- type
- Fetch the file's MIME type and media type.
- Values (separate with | or alternative): size, type
- Default: (empty)
- msflimit
How many files to get.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- msfcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get the filekey, file size, and pixel size of files in the current user's upload stash.
- api.php?action=query&list=mystashedfiles&msfprop=size [open in sandbox]
list=oldreviewedpages (or)
- This module requires read rights.
- This module can be used as a generator.
- Source: FlaggedRevs (Pending Changes)
- License: GPL-2.0-or-later
Enumerates pages that have changes pending review.
- orstart
Start listing at this timestamp.
- Type: timestamp (allowed formats)
- orend
Stop listing at this timestamp.
- Type: timestamp (allowed formats)
- ordir
In which direction to enumerate:
- One of the following values: newer, older
- Default: newer
- ormaxsize
Maximum character count change size.
- Type: integer
- The value must be no less than 0.
- orfilterwatched
How to filter for pages on your watchlist.
- One of the following values: all, watched
- Default: all
- ornamespace
The namespaces to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: 0
- orcategory
Show pages only in the given category.
- orfilterredir
How to filter for redirects.
- One of the following values: all, nonredirects, redirects
- Default: all
- orlimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Show a list of pages with pending unreviewed changes
- api.php?action=query&list=oldreviewedpages&ornamespace=0 [open in sandbox]
- Show info about some old reviewed pages
- api.php?action=query&generator=oldreviewedpages&gorlimit=4&prop=info [open in sandbox]
list=pagecollectionsmetadata
- This module requires read rights.
- Source: WikimediaCampaignEvents
- License: GPL-2.0-or-later
Fetch page collection information for the given title.
- titles
A string containing the page title for which the page collection information will be fetched.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Fetch the page collection information, for the collection defined inside 'TestCollection' page
- api.php?action=query&list=pagecollectionsmetadata&titles=TestCollection [open in sandbox]
list=pagepropnames (ppn)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all page property names in use on the wiki.
- ppncontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ppnlimit
The maximum number of names to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Get first 10 property names.
- api.php?action=query&list=pagepropnames [open in sandbox]
list=pageswithprop (pwp)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all pages using a given page property.
- pwppropname
Page property for which to enumerate pages (action=query&list=pagepropnames returns page property names in use).
- This parameter is required.
- pwpprop
Which pieces of information to include:
- ids
- Adds the page ID.
- title
- Adds the title and namespace ID of the page.
- value
- Adds the value of the page property.
- Values (separate with | or alternative): ids, title, value
- Default: ids|title
- pwpcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- pwplimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pwpdir
In which direction to sort.
- One of the following values: ascending, descending
- Default: ascending
- List the first 10 pages using
{{DISPLAYTITLE:}}. - api.php?action=query&list=pageswithprop&pwppropname=displaytitle&pwpprop=ids|title|value [open in sandbox]
- Get additional information about the first 10 pages using
__NOTOC__. - api.php?action=query&generator=pageswithprop&gpwppropname=notoc&prop=info [open in sandbox]
list=prefixsearch (ps)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform a prefix search for page titles.
Despite the similarity in names, this module is not intended to be equivalent to Special:PrefixIndex; for that, see action=query&list=allpages with the apprefix parameter. The purpose of this module is similar to action=opensearch: to take user input and provide the best-matching titles. Depending on the search engine backend, this might include typo correction, redirect avoidance, or other heuristics.
- pssearch
Search string.
- This parameter is required.
- psnamespace
Namespaces to search. Ignored if pssearch begins with a valid namespace prefix.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: 0
- pslimit
Maximum number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- psoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- The value must be no less than 0.
- Default: 0
- psprofile
Search profile to use.
- strict
- Strict profile with few punctuation characters removed but diacritics and stress marks are kept.
- normal
- Few punctuation characters, some diacritics and stopwords removed.
- fuzzy
- Similar to normal with typo correction (two typos supported).
- fast-fuzzy
- Experimental fuzzy profile (may be removed at any time)
- classic
- Classic prefix, few punctuation characters and some diacritics removed.
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: classic, engine_autoselect, fast-fuzzy, fuzzy, normal, strict
- Default: engine_autoselect
- Search for page titles beginning with meaning.
- api.php?action=query&list=prefixsearch&pssearch=meaning [open in sandbox]
list=projectpages (wpp)
- This module requires read rights.
- This module can be used as a generator.
- Source: PageAssessments
- License: GPL-2.0-or-later
List all pages associated with one or more projects.
- wppassessments
Also return assessments for the pages returned.
- Type: boolean (details)
- wppprojects
The projects to list pages for. If this parameter is omitted, all projects will be included.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wpplimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wppcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get first 10 pages associated with WikiProject Medicine or WikiProject Anatomy.
- api.php?action=query&list=projectpages&wppprojects=Medicine|Anatomy [open in sandbox]
- Get first 10 pages associated with WikiProject Medicine, including assessment data.
- api.php?action=query&list=projectpages&wppprojects=Medicine&wppassessments=true [open in sandbox]
- Get page info for first 10 pages associated with WikiProject Textile Arts.
- api.php?action=query&generator=projectpages&prop=info&gwppprojects=Textile%20Arts [open in sandbox]
list=projects (pj)
- This module requires read rights.
- Source: PageAssessments
- License: GPL-2.0-or-later
List all the projects.
- pjsubprojects
Also include subprojects.
- Type: boolean (details)
- Get a list of all the projects.
- api.php?action=query&list=projects [open in sandbox]
- Get a list of all the projects and subprojects.
- api.php?action=query&list=projects&pjsubprojects=true [open in sandbox]
list=protectedtitles (pt)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all titles protected from creation.
- ptnamespace
Only list titles in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- ptlevel
Only list titles with these protection levels.
- Values (separate with | or alternative): autoconfirmed, extendedconfirmed, sysop, templateeditor
- ptlimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ptdir
In which direction to enumerate:
- newer
- List oldest first. Note: ptstart has to be before ptend.
- older
- List newest first (default). Note: ptstart has to be later than ptend.
- One of the following values: newer, older
- Default: older
- ptstart
Start listing at this protection timestamp.
- Type: timestamp (allowed formats)
- ptend
Stop listing at this protection timestamp.
- Type: timestamp (allowed formats)
- ptprop
Which properties to get:
- timestamp
- Adds the timestamp of when protection was added.
- user
- Adds the user that added the protection.
- userid
- Adds the user ID that added the protection.
- comment
- Adds the comment for the protection.
- parsedcomment
- Adds the parsed comment for the protection.
- expiry
- Adds the timestamp of when the protection will be lifted.
- level
- Adds the protection level.
- Values (separate with | or alternative): comment, expiry, level, parsedcomment, timestamp, user, userid
- Default: timestamp|level
- ptcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List protected titles.
- api.php?action=query&list=protectedtitles [open in sandbox]
- Find links to protected titles in the main namespace.
- api.php?action=query&generator=protectedtitles&gptnamespace=0&prop=linkshere [open in sandbox]
list=querypage (qp)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a list provided by a QueryPage-based special page.
- qppage
The name of the special page. Note, this is case-sensitive.
- This parameter is required.
- One of the following values: Ancientpages, BrokenRedirects, Deadendpages, DisambiguationPageLinks, DisambiguationPages, DoubleRedirects, Fewestrevisions, GadgetUsage, GloballyWantedFiles, LintTemplateErrors, ListDuplicatedFiles, Listredirects, Lonelypages, Longpages, MediaStatistics, MostGloballyLinkedFiles, Mostcategories, Mostimages, Mostinterwikis, Mostlinked, Mostlinkedcategories, Mostlinkedtemplates, Mostrevisions, OrphanedTimedText, Shortpages, Uncategorizedcategories, Uncategorizedimages, Uncategorizedpages, Uncategorizedtemplates, UnconnectedPages, Unusedcategories, Unusedimages, Unusedtemplates, Unwatchedpages, Wantedcategories, Wantedfiles, Wantedpages, Wantedtemplates, Withoutinterwiki
- qpoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- qplimit
Number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
list=random (rn)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a set of random pages.
Pages are listed in a fixed sequence, only the starting point is random. This means that if, for example, Main Page is the first random page in the list, List of fictional monkeys will always be second, List of people on stamps of Vanuatu third, etc.
- rnnamespace
Return pages in these namespaces only.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- rnfilterredir
How to filter for redirects.
- One of the following values: all, nonredirects, redirects
- Default: nonredirects
- rnminsize
Limit to pages with at least this many bytes.
- Type: integer
- rnmaxsize
Limit to pages with at most this many bytes.
- Type: integer
- rncontentmodel
Filter pages that have the specified content model.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- rnredirect
- Deprecated.
Use rnfilterredir=redirects instead.
- Type: boolean (details)
- rnlimit
Limit how many random pages will be returned.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 1
- rncontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Return two random pages from the main namespace.
- api.php?action=query&list=random&rnnamespace=0&rnlimit=2 [open in sandbox]
- Return page info about two random pages from the main namespace.
- api.php?action=query&generator=random&grnnamespace=0&grnlimit=2&prop=info [open in sandbox]
- Return page info about one random page from the main namespace that has at least 500 bytes of text.
- api.php?action=query&list=random&rnnamespace=0&rnlimit=1&minsize=500 [open in sandbox]
list=readinglistentries (rle)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module can be used as a generator.
- Source: ReadingLists
- License: GPL-2.0-or-later
List the pages of a certain list.
This module has three modes of operation. With the rlelists parameter, it returns the pages in the given list(s). With the rlechangedsince parameter, it returns all list entries from any list of the current user which have been changed since the given date. (This is meant for device sync and, unlike the other modes, includes deleted entries, although not entries of deleted lists.) Without any parameters, it returns all entries from all lists of the current user.
- rlelists
The list IDs for which to return pages. Optional. If not specified, returns entries from all lists.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 100 (500 for clients that are allowed higher limits).
- rlechangedsince
Show list entries that have been changed since this timestamp. Must be after 2026-05-09T20:25:23Z.
- Type: timestamp (allowed formats)
- rlesort
Property to sort by. name cannot be used together with rlechangedsince. Defaults to updated when rlechangedsince is set, and to name otherwise.
- name
- Article title. (Project name is ignored. Sorting is by binary value; e.g. any uppercase ASCII character will sort before any lowercase one.)
- updated
- Last update timestamp.
- One of the following values: name, updated
- rledir
Sort direction: ascending (A to Z, oldest to newest) or descending.
- One of the following values: ascending, descending
- Default: ascending
- rlelimit
Number of result items to return.
- Type: integer or max
- The value must be between 1 and 100.
- Default: 10
- rlecontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get all the pages from all reading lists of the current user.
- api.php?action=query&list=readinglistentries [open in sandbox]
- Get the pages from the reading lists with ID 10, 11 and 12.
- api.php?action=query&list=readinglistentries&rlelists=10|11|12 [open in sandbox]
- Get the list entries of the current user which have changed since 2013-01-01T00:00:00Z.
- api.php?action=query&list=readinglistentries&rlechangedsince=2013-01-01T00:00:00Z [open in sandbox]
list=recentchanges (rc)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate recent changes.
- rcstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- rcend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- rcdir
In which direction to enumerate:
- newer
- List oldest first. Note: rcstart has to be before rcend.
- older
- List newest first (default). Note: rcstart has to be later than rcend.
- One of the following values: newer, older
- Default: older
- rcnamespace
Filter changes to only these namespaces.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- rcuser
Only list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rcexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rctag
Only list changes tagged with this tag.
- rcprop
Include additional pieces of information:
- user
- Adds the user responsible for the edit and tags if they are an IP. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds the user ID responsible for the edit. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Adds the comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- flags
- Adds flags for the edit.
- timestamp
- Adds timestamp of the edit.
- title
- Adds the page title of the edit.
- ids
- Adds the page ID, recent changes ID and the new and old revision ID.
- sizes
- Adds the new and old page length in bytes.
- redirect
- Tags edit if page is a redirect.
- patrolled
- Tags patrollable edits as being patrolled or unpatrolled.
- loginfo
- Adds log information (log ID, log type, etc) to log entries.
- tags
- Lists tags for the entry.
- sha1
- Adds the content checksum for entries associated with a revision. If the content has been revision deleted, a sha1hidden property will be returned.
- oresscores
- Adds ORES scores for the entry.
- Values (separate with | or alternative): comment, flags, ids, loginfo, oresscores, parsedcomment, patrolled, redirect, sha1, sizes, tags, timestamp, title, user, userid
- Default: title|timestamp|ids
- rcshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set rcshow=minor|!anon.
When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !oresreview, !patrolled, !redirect, anon, autopatrolled, bot, minor, oresreview, patrolled, redirect, unpatrolled
- rclimit
How many total changes to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- rctype
Which types of changes to show.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- rctoponly
Only list changes which are the latest revision.
- Type: boolean (details)
- rctitle
Filter entries to those related to a page.
- rccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- rcgeneraterevisions
When being used as a generator, generate revision IDs rather than titles. Recent change entries without associated revision IDs (e.g. most log entries) will generate nothing.
- Type: boolean (details)
- rcslot
Only list changes that touch the named slot.
- One of the following values: main
- List recent changes.
- api.php?action=query&list=recentchanges [open in sandbox]
- Get page info about recent unpatrolled changes.
- api.php?action=query&generator=recentchanges&grcshow=!patrolled&prop=info [open in sandbox]
list=search (sr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform a full text search.
- srsearch
Search for page titles or content matching this value. You can use the search string to invoke special search features, depending on what the wiki's search backend implements.
- This parameter is required.
- srnamespace
Search only within these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- Default: 0
- srlimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- sroffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- The value must be no less than 0.
- Default: 0
- srqiprofile
Query independent profile to use (affects ranking algorithm).
- classic
- Ranking based on the number of incoming links, some templates, page language and recency (templates/language/recency may not be activated on this wiki).
- classic_noboostlinks
- Ranking based on some templates, page language and recency when activated on this wiki.
- empty
- Ranking based solely on query dependent features (for debug only).
- wsum_inclinks
- Weighted sum based on incoming links
- wsum_inclinks_pv
- Weighted sum based on incoming links and weekly pageviews
- popular_inclinks_pv
- Ranking based primarily on page views
- popular_inclinks
- Ranking based primarily on incoming link counts
- mlr-1024rs
- Weighted sum based on incoming links and weekly pageviews
- mlr-1024rs-next
- Weighted sum based on incoming links and weekly pageviews
- growth_underlinked
- Internal rescore profile used in GrowthExperiments link recommendations for prioritizing articles which do not yet have enough links. This is a no-op when Link Recommendations are disabled.
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: classic, classic_noboostlinks, empty, engine_autoselect, growth_underlinked, mlr-1024rs, mlr-1024rs-next, popular_inclinks, popular_inclinks_pv, wsum_inclinks, wsum_inclinks_pv
- Default: engine_autoselect
- srqdprofile
Query dependent profile to use (affects ranking algorithm).
- default
- (no description)
- perfield_builder
- (no description)
- perfield_builder_relaxed
- (no description)
- perfield_builder_title_filter
- (no description)
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: default, engine_autoselect, perfield_builder, perfield_builder_relaxed, perfield_builder_title_filter
- Default: engine_autoselect
- srwhat
Which type of search to perform.
- One of the following values: nearmatch, text, title
- srinfo
Which metadata to return.
- Values (separate with | or alternative): rewrittenquery, suggestion, totalhits
- Default: totalhits|suggestion|rewrittenquery
- srprop
Which properties to return:
- size
- Adds the size of the page in bytes.
- wordcount
- Adds the word count of the page.
- timestamp
- Adds the timestamp of when the page was last edited.
- snippet
- Adds a snippet of the page, with query term highlighting markup.
- titlesnippet
- Adds the page title, with query term highlighting markup.
- redirecttitle
- Adds the title of the matching redirect.
- redirectsnippet
- Adds the title of the matching redirect, with query term highlighting markup.
- sectiontitle
- Adds the title of the matching section.
- sectionsnippet
- Adds the title of the matching section, with query term highlighting markup.
- isfilematch
- Adds a boolean indicating if the search matched file content.
- categorysnippet
- Adds the matching category name, with query term highlighting markup.
- score
- Deprecated. Ignored.
- hasrelated
- Deprecated. Ignored.
- extensiondata
- Adds extra data generated by extensions.
- Values (separate with | or alternative): categorysnippet, extensiondata, isfilematch, redirectsnippet, redirecttitle, sectionsnippet, sectiontitle, size, snippet, timestamp, titlesnippet, wordcount, hasrelated, score
- Default: size|wordcount|timestamp|snippet
- srinterwiki
Include interwiki results in the search, if available.
- Type: boolean (details)
- srenablerewrites
Enable internal query rewriting. Some search backends can rewrite the query into another which is thought to provide better results, for instance by correcting spelling errors.
- Type: boolean (details)
- srsort
Set the sort order of returned results.
- One of the following values: create_timestamp_asc, create_timestamp_desc, incoming_links_asc, incoming_links_desc, just_match, last_edit_asc, last_edit_desc, none, random, relevance, title_natural_asc, title_natural_desc, user_random
- Default: relevance
- Search for meaning.
- api.php?action=query&list=search&srsearch=meaning [open in sandbox]
- Search texts for meaning.
- api.php?action=query&list=search&srwhat=text&srsearch=meaning [open in sandbox]
- Get page info about the pages returned for a search for meaning.
- api.php?action=query&generator=search&gsrsearch=meaning&prop=info [open in sandbox]
list=tags (tg)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List change tags.
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
The maximum number of tags to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
Which properties to get:
- displayname
- Adds the displayed name of the tag. This property will be omitted for hidden tags.
- description
- Adds the description of the tag.
- hitcount
- Adds the number of revisions and log entries that have this tag.
- defined
- Indicate whether the tag is defined (see source).
- source
- Gets the sources of the tag definition, which may include software for software-defined tags and manual for tags that may be applied manually by users.
- active
- Whether the tag is still being applied by the software, or may still be applied by users.
- Values (separate with | or alternative): active, defined, description, displayname, hitcount, source
- Default: (empty)
list=trackingcategories (tc)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- tccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- tctrackingcatname
Search for all existing tracking category titles that match the provided tracking category name (as defined by "message name" on Special:TrackingCategories.)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- tcmin
Only return existing tracking categories with at least this many members.
- Type: integer
- tcmax
Only return existing tracking categories with at most this many members.
- Type: integer
- tclimit
How many tracking categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- tcprop
Which properties to get:
- size
- Adds number of pages in the tracking category.
- hidden
- Tags tracking categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, size
- Default: (empty)
- List tracking categories with information on the number of pages in each.
- api.php?action=query&list=trackingcategories&tcprop=size [open in sandbox]
- Retrieve info about the tracking category pages representing the broken-file-category themselves, if they exist
- api.php?action=query&generator=trackingcategories>ctrackingcatname=broken-file-category&prop=info [open in sandbox]
list=usercontribs (uc)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get all edits by a user.
- uclimit
The maximum number of contributions to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ucstart
The start timestamp to return from, i.e. revisions before this timestamp.
- Type: timestamp (allowed formats)
- ucend
The end timestamp to return to, i.e. revisions after this timestamp.
- Type: timestamp (allowed formats)
- uccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ucuser
The users to retrieve contributions for. Cannot be used with ucuserids, ucuserprefix, or uciprange.
- Type: list of users, by any of username, IP, Temporary user and interwiki name (e.g. "prefix>ExampleName")
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ucuserids
The user IDs to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or uciprange.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ucuserprefix
Retrieve contributions for all users whose names begin with this value. Cannot be used with ucuser, ucuserids, or uciprange.
- uciprange
The CIDR range to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or ucuserids.
- ucdir
In which direction to enumerate:
- newer
- List oldest first. Note: ucstart has to be before ucend.
- older
- List newest first (default). Note: ucstart has to be later than ucend.
- One of the following values: newer, older
- Default: older
- ucnamespace
Only list contributions in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- ucprop
Include additional pieces of information:
- ids
- Adds the page ID and revision ID.
- title
- Adds the title and namespace ID of the page.
- timestamp
- Adds the timestamp of the edit.
- comment
- Adds the comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- size
- Adds the new size of the edit.
- sizediff
- Adds the size delta of the edit against its parent.
- flags
- Adds flags of the edit.
- patrolled
- Tags patrolled edits.
- tags
- Lists tags for the edit.
- oresscores
- Adds ORES scores for the edit.
- Values (separate with | or alternative): comment, flags, ids, oresscores, parsedcomment, patrolled, size, sizediff, tags, timestamp, title
- Default: ids|title|timestamp|comment|size|flags
- ucshow
Show only items that meet these criteria, e.g. non minor edits only: ucshow=!minor.
If ucshow=patrolled or ucshow=!patrolled is set, revisions older than $wgRCMaxAge (2592000 seconds) won't be shown.
When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.
- Values (separate with | or alternative): !autopatrolled, !minor, !new, !oresreview, !patrolled, !top, autopatrolled, minor, new, oresreview, patrolled, top
- uctag
Only list revisions tagged with this tag.
- uctoponly
- Deprecated.
Only list changes which are the latest revision.
- Type: boolean (details)
- Show contributions of user Example.
- api.php?action=query&list=usercontribs&ucuser=Example [open in sandbox]
- Show contributions from all IP addresses with prefix 192.0.2..
- api.php?action=query&list=usercontribs&ucuserprefix=192.0.2. [open in sandbox]
list=users (us)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get information about a list of users.
- usprop
Which pieces of information to include:
- blockinfo
- Tags if the user is blocked, by whom, and for what reason.
- groups
- Lists all the groups each user belongs to.
- groupmemberships
- Lists groups that each user has been explicitly assigned to, including the expiry date of each group membership.
- implicitgroups
- Lists all the groups a user is automatically a member of.
- rights
- Lists all the rights each user has.
- editcount
- Adds the user's edit count.
- registration
- Adds the user's registration timestamp.
- emailable
- Tags if the user can and wants to receive email through Special:Emailuser.
- gender
- Tags the gender of the user. Returns "male", "female", or "unknown".
- centralids
- Adds the central IDs and attachment status for the user.
- cancreate
- Indicates whether an account for valid but unregistered usernames can be created. To check whether the current user can perform the account creation, use action=query&meta=userinfo&uiprop=cancreateaccount.
- tempexpired
- Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
- Values (separate with | or alternative): blockinfo, cancreate, centralids, editcount, emailable, gender, groupmemberships, groups, implicitgroups, registration, rights, tempexpired
- usattachedwiki
With usprop=centralids, indicate whether the user is attached with the wiki identified by this ID.
- ususers
A list of users to obtain information for.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ususerids
A list of user IDs to obtain information for.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Return information for user Example.
- api.php?action=query&list=users&ususers=Example&usprop=groups|editcount|gender [open in sandbox]
list=watchlist (wl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get recent changes to pages in the current user's watchlist.
- wlallrev
Include multiple revisions of the same page within given timeframe.
- Type: boolean (details)
- wlstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- wlend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- wlnamespace
Filter changes to only the given namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- wluser
Only list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- wlexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- wldir
In which direction to enumerate:
- newer
- List oldest first. Note: wlstart has to be before wlend.
- older
- List newest first (default). Note: wlstart has to be later than wlend.
- One of the following values: newer, older
- Default: older
- wllimit
How many total results to return per request.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wlprop
Which additional properties to get:
- ids
- Adds revision IDs and page IDs.
- title
- Adds title of the page.
- flags
- Adds flags for the edit.
- user
- Adds the user who made the edit. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds user ID of whoever made the edit. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Adds comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- timestamp
- Adds timestamp of the edit.
- patrol
- Tags edits that are patrolled.
- sizes
- Adds the old and new lengths of the page.
- notificationtimestamp
- Adds timestamp of when the user was last notified about the edit.
- loginfo
- Adds log information where appropriate.
- tags
- Lists tags for the entry.
- expiry
- Adds the expiry time.
- labels
- Adds watchlist labels associated with the entry.
- oresscores
- Adds ORES scores for the edit.
- Values (separate with | or alternative): comment, expiry, flags, ids, labels, loginfo, notificationtimestamp, oresscores, parsedcomment, patrol, sizes, tags, timestamp, title, user, userid
- Default: ids|title|flags
- wlshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set wlshow=minor|!anon.
When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !oresreview, !patrolled, !unread, anon, autopatrolled, bot, minor, oresreview, patrolled, unread
- wltype
Which types of changes to show:
- edit
- Regular page edits.
- new
- Page creations.
- log
- Log entries.
- external
- External changes.
- categorize
- Category membership changes.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- wllabels
Only list changes with these watchlist label IDs.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wlowner
Used along with wltoken to access a different user's watchlist.
- Type: user, by username
- wltoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wlcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the top revision for recently changed pages on the current user's watchlist.
- api.php?action=query&list=watchlist [open in sandbox]
- Fetch additional information about the top revision for recently changed pages on the current user's watchlist.
- api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment [open in sandbox]
- Fetch additional information about the top revision for recently changed pages on the current user's watchlist, including when temporarily watched items will expire.
- api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment|expiry [open in sandbox]
- Fetch information about all recent changes to pages on the current user's watchlist.
- api.php?action=query&list=watchlist&wlallrev=&wlprop=ids|title|timestamp|user|comment [open in sandbox]
- Fetch page info for recently changed pages on the current user's watchlist.
- api.php?action=query&generator=watchlist&prop=info [open in sandbox]
- Fetch revision info for recent changes to pages on the current user's watchlist.
- api.php?action=query&generator=watchlist&gwlallrev=&prop=revisions&rvprop=timestamp|user [open in sandbox]
- List the top revision for recently changed pages on the watchlist of user Example.
- api.php?action=query&list=watchlist&wlowner=Example&wltoken=123ABC [open in sandbox]
list=watchlistraw (wr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get all pages on the current user's watchlist.
- wrcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- wrnamespace
Only list pages in the given namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- To specify all values, use *.
- wrlimit
How many total results to return per request.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wrprop
Which additional properties to get:
- changed
- Adds timestamp of when the user was last notified about the edit.
- Values (separate with | or alternative): changed
- wrshow
Only list items that meet these criteria.
- Values (separate with | or alternative): !changed, changed
- wrowner
Used along with wrtoken to access a different user's watchlist.
- Type: user, by username
- wrtoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wrdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- wrfromtitle
Title (with namespace prefix) to begin enumerating from.
- wrtotitle
Title (with namespace prefix) to stop enumerating at.
- List pages on the current user's watchlist.
- api.php?action=query&list=watchlistraw [open in sandbox]
- Fetch page info for pages on the current user's watchlist.
- api.php?action=query&generator=watchlistraw&gwrshow=changed&prop=info [open in sandbox]
list=wblistentityusage (wbleu)
- This module requires read rights.
- This module can be used as a generator.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Returns all pages that use the given entity IDs.
- wbleuprop
Properties to add to the result.
- url
- If enabled the url of the entity will be added to the result.
- Values (separate with | or alternative): url
- wbleuaspect
Only return entity IDs that used this aspect.
- S
- The entity's sitelinks are used
- L
- The entity's label is used
- D
- The entity's description is used
- T
- The title of the local page corresponding to the entity is used
- C
- Statements from the entity are used
- X
- All aspects of an entity are or may be used
- O
- Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
- Values (separate with | or alternative): C, D, L, O, S, T, X
- wbleuentities
Entities that have been used.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wbleulimit
How many entity usages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wbleucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get pages that use the entity Q2.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2 [open in sandbox]
- Get pages that use the entity Q2 with URL included.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2&wbleuprop=url [open in sandbox]
- Get pages that use the entity Q2 and the aspect was sitelink or statement.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2&wbleuaspect=S|O [open in sandbox]
list=wikisets (ws)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Enumerate all wiki sets.
- wsfrom
The name of the wiki set to start from.
- wsprop
What pieces of information to include:
- type
- Opt-in based (includes only specified wikis) or opt-out based (includes all wikis except specified).
- wikisincluded
- The wikis that are included in this wiki set.
- wikisnotincluded
- The wikis that are not included in this wiki set.
- Values (separate with | or alternative): type, wikisincluded, wikisnotincluded
- wslimit
How many wiki sets to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wsorderbyname
Order results by name.
- Type: boolean (details)
- List wiki sets
- api.php?action=query&list=wikisets [open in sandbox]
- Show wiki sets with types
- api.php?action=query&list=wikisets&wsprop=type&wslimit=200 [open in sandbox]
meta=allmessages (am)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return messages from this site.
- ammessages
Which messages to output. * (default) means all messages.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: *
- amprop
Which properties to get.
- Values (separate with | or alternative): default
- amenableparser
Set to enable parser, will preprocess the wikitext of message (substitute magic words, handle templates, etc.).
- Type: boolean (details)
- amnocontent
If set, do not include the content of the messages in the output.
- Type: boolean (details)
- amincludelocal
Also include local messages, i.e. messages that don't exist in the software but do exist as in the MediaWiki namespace.
This lists all MediaWiki-namespace pages, so it will also list those that aren't really messages such as Common.js.
- Type: boolean (details)
- amargs
Arguments to be substituted into message.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- amfilter
Return only messages with names that contain this string.
- amcustomised
Return only messages in this customisation state.
- One of the following values: all, modified, unmodified
- Default: all
- amlang
Return messages in this language.
- amfrom
Return messages starting at this message.
- amto
Return messages ending at this message.
- amtitle
Page name to use as context when parsing message (for amenableparser option).
- amprefix
Return messages with this prefix.
- Show messages starting with ipb-.
- api.php?action=query&meta=allmessages&refix=ipb- [open in sandbox]
- Show messages august and mainpage in German.
- api.php?action=query&meta=allmessages&ammessages=august|mainpage&amlang=de [open in sandbox]
meta=authmanagerinfo (ami)
- Source: MediaWiki
- License: GPL-2.0-or-later
Retrieve information about the current authentication status.
- amisecuritysensitiveoperation
Test whether the user's current authentication status is sufficient for the specified security-sensitive operation.
- amirequestsfor
Fetch information about the authentication requests needed for the specified authentication action.
- One of the following values: change, create, create-continue, link, link-continue, login, login-continue, remove, unlink
- amireauthenticate
Add requests needed to reauthenticate for a security-sensitive operation. Must be used with amirequestsfor=login and while in a logged-in session. The value of the parameter is the operation name, which can be found in the reauthenticate error returned when trying the operation that needs reauthentication.
- amimergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- amimessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- Fetch the requests that may be used when beginning a login.
- api.php?action=query&meta=authmanagerinfo&amirequestsfor=login [open in sandbox]
- Fetch the requests that may be used when beginning a login, with form fields merged.
- api.php?action=query&meta=authmanagerinfo&amirequestsfor=login&amimergerequestfields=1 [open in sandbox]
- Test whether authentication is sufficient for action foo.
- api.php?action=query&meta=authmanagerinfo&amisecuritysensitiveoperation=foo [open in sandbox]
meta=babel (bab)
- This module requires read rights.
- Source: Babel
- License: GPL-2.0-or-later
Get information about what languages the user knows
- babuser
User to get information about
- This parameter is required.
- Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
- Get the Babel information for user Example
- api.php?action=query&meta=babel&babuser=Example [open in sandbox]
meta=checkuserformattedblockinfo
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CheckUser
- License: GPL-2.0-or-later
Return formatted block details for sitewide blocks affecting the current user.
meta=communityconfiguration (ccr)
- This module requires read rights.
- Source: CommunityConfiguration
- License: GPL-3.0-or-later
Read the community configuration
- ccrprovider
Community configuration provider ID
- This parameter is required.
- One of the following values: Babel, BlockedDomain, CampaignEvents, CommunityUpdates, ContentTranslation, GrowthHomepage, GrowthMentorList, GrowthSuggestedEdits, HelpPanel, Mentorship, ReportIncident, TemplateData-FeaturedTemplates
- ccrassertversion
Assert specific version
meta=cxconfig
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get ContentTranslation local configuration settings.
- Get ContentTranslation local featured collection configuration.
- api.php?action=query&meta=cxconfig [open in sandbox]
meta=cxdeletedtranslations (dt)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Get the number of your published translations that were deleted.
- dtafter
Timestamp to get only newer deletions.
- Type: timestamp (allowed formats)
- dtnamespace
Namespace in which the deleted translations were published. Defaults to the main namespace.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
- Get the number of your deleted translations, which were published to main namespace and deleted after 2019-04-07 16:24:44
- api.php?action=query&meta=cxdeletedtranslations&dtafter=2019-04-07T16%3A24%3A44.000Z&dtnamespace=0 [open in sandbox]
meta=featureusage (afu)
- This module requires read rights.
- Source: ApiFeatureUsage
- License: GPL-2.0-or-later
Get a summary of logged API feature usages for a user agent.
- afustart
Start of date range to query.
- Type: timestamp (allowed formats)
- afuend
End of date range to query.
- Type: timestamp (allowed formats)
- afuagent
User agent to query. If not specified, the agent in the request will be queried.
- afufeatures
If specified, return details on only these features.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Query feature usage for the current user agent
- api.php?action=query&meta=featureusage [open in sandbox]
meta=filerepoinfo (fri)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return meta information about image repositories configured on the wiki.
- friprop
Which repository properties to get (properties available may vary on other wikis).
- canUpload
- Whether files can be uploaded to this repository, e.g. via CORS and shared authentication.
- descBaseUrl
- (no description)
- descriptionCacheExpiry
- (no description)
- displayname
- The human-readable name of the repository wiki.
- favicon
- Repository wiki's favicon URL, from $wgFavicon.
- fetchDescription
- Whether file description pages are fetched from this repository when viewing local file description pages.
- initialCapital
- Whether file names implicitly start with a capital letter.
- local
- Whether that repository is the local one or not.
- name
- The key of the repository - used in e.g. $wgForeignFileRepos and imageinfo return values.
- rootUrl
- Root URL path for image paths.
- scriptDirUrl
- Root URL path for the repository wiki's MediaWiki installation.
- thumbUrl
- Root URL path for thumbnail paths.
- url
- Public zone URL path.
- Values (separate with | or alternative): canUpload, descBaseUrl, descriptionCacheExpiry, displayname, favicon, fetchDescription, initialCapital, local, name, rootUrl, scriptDirUrl, thumbUrl, url
- Default: canUpload|descBaseUrl|descriptionCacheExpiry|displayname|favicon|fetchDescription|initialCapital|local|name|rootUrl|scriptDirUrl|thumbUrl|url
- Get information about file repositories.
- api.php?action=query&meta=filerepoinfo&friprop=name|displayname [open in sandbox]
meta=globalpreferences (gpr)
- This module requires read rights.
- Source: GlobalPreferences
- License: GPL-2.0-or-later
Retrieve global preferences for the current user.
Can retrieve both global preferences and their local overrides.
- gprprop
Which prererences to include:
- preferences
- Global preferences.
- localoverrides
- Local overrides for global preferences.
- Values (separate with | or alternative): localoverrides, preferences
- Default: preferences|localoverrides
meta=globalrenamestatus (grs)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Show information about global renames that are in progress.
- grsuser
User that is being renamed. Can be either their old name or new name.
- Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
- Get information about the current global user
- api.php?action=query&meta=globalrenamestatus [open in sandbox]
meta=globaluserinfo (gui)
- This module requires read rights.
- Source: CentralAuth
- License: GPL-2.0-or-later
Show information about a global user.
- guiuser
User to get information about. If guiuser and guiid both are omitted, it defaults to the current user.
- Type: user, by any of username, Temporary user and interwiki name (e.g. "prefix>ExampleName")
- guiid
Global user ID to get information about. If guiuser and guiid both are omitted, it defaults to the current user.
- Type: integer
- guiprop
Which properties to get:
- groups
- Get a list of global groups this user belongs to.
- rights
- Get a list of global rights this user has.
- merged
- Get a list of merged accounts.
- unattached
- Get a list of unattached accounts.
- editcount
- Get the user's global edit count.
- Values (separate with | or alternative): editcount, groups, merged, rights, unattached
- Get information about the current global user
- api.php?action=query&meta=globaluserinfo [open in sandbox]
- Get information about global user Example
- api.php?action=query&meta=globaluserinfo&guiuser=Example&guiprop=groups|merged|unattached [open in sandbox]
meta=growthmenteestatus
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Query current user's mentee status; see documentation of action=growthsetmenteestatus for detailed information about individual statuses.
meta=growthmentorstatus
- This module requires read rights.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Query current user's mentor status
meta=growthnextsuggestedtasktype (gnstt)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: GrowthExperiments
- License: GPL-3.0-or-later
Get a suggested task type for a user to try next.
- gnsttactivetasktype
The task type that the user is currently working on.
- This parameter is required.
- One of the following values: copyedit, expand, link-recommendation, links, references, revise-tone, update
meta=languageinfo (li)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return information about available languages.
Continuation may be applied if retrieving the information takes too long for one request.
- liprop
Which information to get for each language.
- code
- The language code. (This code is MediaWiki-specific, though there are overlaps with other standards.)
- bcp47
- The BCP-47 language code.
- dir
- The writing direction of the language (either
ltrorrtl). - autonym
- The autonym of the language, that is, the name in that language.
- name
- The name of the language in the language specified by the uselang parameter, with language fallbacks applied if necessary.
- variantnames
- The short names for language variants used for language conversion links.
- fallbacks
- The language codes of the fallback languages configured for this language. The implicit final fallback to 'en' is not included (but some languages may fall back to 'en' explicitly).
- variants
- The language codes of the variants supported by this language.
- digittransforms
- The digit transforms for formatting numbers in this language.
- digitgroupingpattern
- The grouping pattern for formatting numbers in this language.
- minimumgroupingdigits
- The number of digits below which grouping of numerals is suppressed.
- namespacenames
- The names of this wiki's namespaces in this language.
- namespacealiases
- The aliases for the namespace names in this wiki in this language.
- Values (separate with | or alternative): autonym, bcp47, code, digitgroupingpattern, digittransforms, dir, fallbacks, minimumgroupingdigits, name, namespacealiases, namespacenames, variantnames, variants
- Default: code
- licode
Language codes of the languages that should be returned, or
*for all languages.- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: *
- licontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get the language codes of all supported languages.
- api.php?action=query&meta=languageinfo [open in sandbox]
- Get the autonyms and German names of all supported languages.
- api.php?action=query&meta=languageinfo&liprop=autonym|name&uselang=de [open in sandbox]
- Get the fallback languages and variants of Occitan.
- api.php?action=query&meta=languageinfo&liprop=fallbacks|variants&licode=oc [open in sandbox]
- Get the BCP-47 language code and direction of all supported languages.
- api.php?action=query&meta=languageinfo&liprop=bcp47|dir [open in sandbox]
meta=linterstats (lntrst)
- This module requires read rights.
- Source: Linter
- License: GPL-2.0-or-later
Get number of lint errors in each category
- Get number of lint errors in each category
- api.php?action=query&meta=linterstats [open in sandbox]
meta=notifications (not)
- This module requires read rights.
- Source: Echo
- License: MIT
Get notifications waiting for the current user.
- notwikis
List of wikis to fetch notifications from (defaults to only current wiki).
- Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: enwiki
- notfilter
Filter notifications returned.
- Values (separate with | or alternative): !read, read
- Default: read|!read
- notprop
Details to request.
- Values (separate with | or alternative): count, list, seenTime
- Default: list
- notsections
The notification sections to query (i.e. some combination of 'alert' and 'message').
- Values (separate with | or alternative): alert, message
- Default: alert|message
- notgroupbysection
Whether to group the result by section. Each section is fetched separately if set.
- Type: boolean (details)
- notformat
If specified, notifications will be returned formatted this way.
- model
- Raw notification data
- special
- Formatted for Special:Notifications page (and only that!) Do not rely on the HTML as it may change at any given time.
- flyout
- Deprecated. Use notformat=model for raw data
- html
- Deprecated. Use notformat=model for raw data
- One of the following values: flyout, html, model, special
- notlimit
The maximum number of notifications to return.
- Type: integer or max
- The value must be between 1 and 50.
- Default: 20
- notcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- notunreadfirst
Whether to show unread notifications first (only used if groupbysection is not set).
- Type: boolean (details)
- nottitles
Only return notifications for these pages. To get notifications not associated with any page, use [] as a title.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- notbundle
Whether to show bundle compatible unread notifications according to notification types bundling rules.
- Type: boolean (details)
- notnotifiertypes
Notifier types for which to return notifications.
- Values (separate with | or alternative): email, push, web
- Default: web
- notalertcontinue
When more alert results are available, use this to continue.
- notalertunreadfirst
Whether to show unread message notifications first (only used if groupbysection is set).
- Type: boolean (details)
- notmessagecontinue
When more message results are available, use this to continue.
- notmessageunreadfirst
Whether to show unread alert notifications first (only used if groupbysection is set).
- Type: boolean (details)
- notcrosswikisummary
True to opt in to a summary notification of notifications on foreign wikis.
- Type: boolean (details)
- List web notifications
- api.php?action=query&meta=notifications [open in sandbox]
- List web notifications, grouped by section, with counts
- api.php?action=query&meta=notifications¬prop=count¬sections=alert|message¬groupbysection=1 [open in sandbox]
- List email notifications
- api.php?action=query&meta=notifications¬notifiertypes=email [open in sandbox]
meta=ores (ores)
- This module requires read rights.
- Source: Machine Learning Platform
- License: GPL-3.0-or-later
Return ORES configuration and model data for this wiki.
- Fetch ORES data:
- api.php?action=query&meta=ores [open in sandbox]
meta=readinglists (rl)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: ReadingLists
- License: GPL-2.0-or-later
List or filter the user's reading lists and show metadata about them.
This module has four modes of operation. With the rllist parameter, it returns information about the specified list. With the rlchangedsince parameter, it returns all lists of the current user which have been changed since the given date. (This is meant for device sync and, unlike the other modes, includes deleted lists. Only changes to list metadata are considered, not changes to list items.) With the rlproject and rltitle parameters, it returns all lists that include that page. Without any of those parameters, it returns all lists.
- rllist
List ID.
- Type: integer
- The value must be no less than 1.
- rlproject
Project of the page to filter on. Must be used together with rltitle. Will only return lists which include this project and title.
- rltitle
Title of the page to filter on. Must be used together with rlproject. Will only return lists which include this project and title.
- rlchangedsince
Show lists that have been changed since this timestamp. Must be after 2026-05-09T20:25:24Z. Clients should use the timestamp returned in the readinglists-synctimestamp field from an earlier call if they want to ensure that no changes are missed, and should be prepared to receive changes that have already been returned in an earlier response, and handle them in an idempotent way.
- Type: timestamp (allowed formats)
- rlsort
Property to sort by. Ignored when rlproject and rltitle is set (results are returned in DB order). Defaults to updated when rlchangedsince is set, and to name otherwise.
- name
- List name. (Sorting is by binary value; e.g. any uppercase ASCII character will sort before any lowercase one.)
- updated
- Last update timestamp. (Updates include list metadata changes but not changes to list items.)
- One of the following values: name, updated
- rldir
Sort direction: ascending (A to Z, oldest to newest) or descending. Ignored when rlproject and rltitle is set.
- One of the following values: ascending, descending
- Default: ascending
- rllimit
Number of result items to return.
- Type: integer or max
- The value must be between 1 and 12.
- Default: 10
- rlcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get the reading lists of the current user.
- api.php?action=query&meta=readinglists [open in sandbox]
- Get the reading lists of the current user which have changed since 2013-01-01T00:00:00Z.
- api.php?action=query&meta=readinglists&rlchangedsince=2013-01-01T00:00:00Z [open in sandbox]
- Get the reading lists of the current user which contain the page Dog from project en.wikipedia.org
- api.php?action=query&meta=readinglists&rlproject=https%3A%2F%2Fen.wikipedia.org&rltitle=Dog [open in sandbox]
meta=siteinfo (si)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return general information about the site.
- siprop
Which information to get:
- general
- Overall system information.
- namespaces
- List of registered namespaces and their canonical names.
- namespacealiases
- List of registered namespace aliases.
- specialpagealiases
- List of special page aliases.
- magicwords
- List of magic words and their aliases.
- interwikimap
- Returns interwiki map (optionally filtered, optionally localised by using siinlanguagecode).
- dbrepllag
- Returns database server with the highest replication lag.
- statistics
- Returns site statistics.
- usergroups
- Returns user groups and the associated permissions.
- autocreatetempuser
- Returns configuration for the automatic creation of temporary user accounts (also known as IP masking).
- clientlibraries
- Returns client-side libraries installed on the wiki
- libraries
- Returns libraries installed on the wiki.
- extensions
- Returns extensions installed on the wiki.
- fileextensions
- Returns list of file extensions (file types) allowed to be uploaded.
- rightsinfo
- Returns wiki rights (license) information if available.
- restrictions
- Returns information on available restriction (protection) types.
- languages
- Returns a list of languages MediaWiki supports (optionally localised by using siinlanguagecode).
- languagevariants
- Returns a list of language codes for which LanguageConverter is enabled, and the variants supported for each.
- skins
- Returns a list of all enabled skins (optionally localised by using siinlanguagecode, otherwise in the content language).
- extensiontags
- Returns a list of parser extension tags.
- functionhooks
- Returns a list of magic word IDs for parser functions.
- showhooks
- Returns a list of all subscribed hooks (contents of $wgHooks).
- variables
- Returns a list of magic word IDs for magic variables.
- doubleunderscores
- Returns a list of magic word IDs for behavior switches.
- protocols
- Returns a list of protocols that are allowed in external links.
- defaultoptions
- Returns the default values for user preferences.
- uploaddialog
- Returns the upload dialog configuration.
- autopromote
- Returns the automatic promotion configuration.
- autopromoteonce
- Returns the automatic promotion configuration that are only done once.
- copyuploaddomains
- Returns the list of allowed copy upload domains
- sbom
- Returns a Software Bill of Materials (SBOM) for the MediaWiki installation in the CycloneDX 1.6 format.
- Values (separate with | or alternative): autocreatetempuser, autopromote, autopromoteonce, clientlibraries, copyuploaddomains, dbrepllag, defaultoptions, doubleunderscores, extensions, extensiontags, fileextensions, functionhooks, general, interwikimap, languages, languagevariants, libraries, magicwords, namespacealiases, namespaces, protocols, restrictions, rightsinfo, sbom, showhooks, skins, specialpagealiases, statistics, uploaddialog, usergroups, variables
- Default: general
- sifilteriw
Return only local or only nonlocal entries of the interwiki map.
- One of the following values: !local, local
- sishowalldb
List all database servers, not just the one lagging the most.
- Type: boolean (details)
- sinumberingroup
Lists the number of users in user groups.
- Type: boolean (details)
- siinlanguagecode
Language code for localised language names (best effort) and skin names.
- Fetch site information.
- api.php?action=query&meta=siteinfo&siprop=general|namespaces|namespacealiases|statistics [open in sandbox]
- Fetch a list of local interwiki prefixes.
- api.php?action=query&meta=siteinfo&siprop=interwikimap&sifilteriw=local [open in sandbox]
- Check the current replication lag.
- api.php?action=query&meta=siteinfo&siprop=dbrepllag&sishowalldb= [open in sandbox]
meta=siteviews (pvis)
- This module requires read rights.
- Source: PageViewInfo
- License: GPL-3.0-or-later
Shows sitewide pageview data (daily pageview totals for each of the last pvisdays days).
The result format is date (Ymd) => count.
- pvismetric
The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)
- pageviews
- Plain pageviews.
- uniques
- Unique visitors.
- One of the following values: pageviews, uniques
- Default: pageviews
- pvisdays
The number of days to show.
- Type: integer
- The value must be between 1 and 60.
- Default: 60
- Show sitewide pageview totals.
- api.php?action=query&meta=siteviews [open in sandbox]
- Show sitewide unique visitor totals.
- api.php?action=query&meta=siteviews&pvismetric=uniques [open in sandbox]
meta=tokens
- Source: MediaWiki
- License: GPL-2.0-or-later
Gets tokens for data-modifying actions.
- type
Types of token to request.
- Values (separate with | or alternative): createaccount, csrf, deleteglobalaccount, login, patrol, rollback, setglobalaccountstatus, userrights, watch
- To specify all values, use *.
- Default: csrf
- Retrieve a csrf token (the default).
- api.php?action=query&meta=tokens [open in sandbox]
- Retrieve a watch token and a patrol token.
- api.php?action=query&meta=tokens&type=watch|patrol [open in sandbox]
meta=unreadnotificationpages (unp)
- This module requires read rights.
- Source: Echo
- License: MIT
Get pages for which there are unread notifications for the current user.
- unpwikis
List of wikis to fetch pages with unread notifications from (defaults to only current wiki).
- Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: enwiki
- unpgrouppages
Group talk pages together with their subject page, and group notifications not associated with a page together with the current user's user page.
- Type: boolean (details)
- unplimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 10,000.
- Default: 10
- List pages with (their amount of) unread notifications
- api.php?action=query&meta=unreadnotificationpages [open in sandbox]
meta=userinfo (ui)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get information about the current user.
- uiprop
Which pieces of information to include:
- blockinfo
- Tags if the current user is blocked, by whom, and for what reason.
- hasmsg
- Adds a tag messages if the current user has pending messages.
- groups
- Lists all the groups the current user belongs to.
- groupmemberships
- Lists groups that the current user has been explicitly assigned to, including the expiry date of each group membership.
- implicitgroups
- Lists all the groups the current user is automatically a member of.
- rights
- Lists all the rights the current user has.
- changeablegroups
- Lists the groups the current user can add to and remove from.
- options
- Lists all preferences the current user has set.
- editcount
- Adds the current user's edit count.
- ratelimits
- Lists all rate limits applying to the current user.
- theoreticalratelimits
- Lists all rate limits that would apply to the current user if they were not exempt from all ratelimits based on user rights or ip.
- Adds the user's email address and email authentication date.
- realname
- Adds the user's real name.
- acceptlang
- Echoes the
Accept-Languageheader sent by the client in a structured format. - registrationdate
- Adds the user's registration date.
- unreadcount
- Adds the count of unread pages on the user's watchlist (maximum 999; returns 1000+ if more).
- watchlistlabels
- Adds watchlist labels the user has set up.
- centralids
- Adds the central IDs and attachment status for the user.
- latestcontrib
- Adds the date of user's latest contribution.
- cancreateaccount
- Indicates whether the user is allowed to create accounts. To check whether some specific account can be created, use action=query&list=users&usprop=cancreate.
- Values (separate with | or alternative): acceptlang, blockinfo, cancreateaccount, centralids, changeablegroups, editcount, email, groupmemberships, groups, hasmsg, implicitgroups, latestcontrib, options, ratelimits, realname, registrationdate, rights, theoreticalratelimits, unreadcount, watchlistlabels
- To specify all values, use *.
- uiattachedwiki
With uiprop=centralids, indicate whether the user is attached with the wiki identified by this ID.
- Get information about the current user.
- api.php?action=query&meta=userinfo [open in sandbox]
- Get additional information about the current user.
- api.php?action=query&meta=userinfo&uiprop=blockinfo|groups|rights|hasmsg [open in sandbox]
meta=wikibase (wb)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get information about the Wikibase client and the associated Wikibase repository.
- wbprop
Which properties to get:
- url
- Base URL, script path and article path of the Wikibase repository.
- siteid
- The siteid of this site.
- Values (separate with | or alternative): siteid, url
- Default: url|siteid
- Get URL path and other information about Wikibase client and repository.
- api.php?action=query&meta=wikibase [open in sandbox]
action=readinglists
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Reading list write operations.
Create/update/delete/sort reading lists and entries. See the documentation of the various commands for details.
- command
Command (API submodule) for reading list write operations.
- create
- Internal. Create a new list for the current user.
- createentry
- Internal. Add a new page to a list belonging to the current user.
- delete
- Internal. Delete a list belonging to the current user.
- deleteentry
- Internal. Delete a page from a list belonging to the current user.
- setup
- Internal. Enable lists for the current user.
- teardown
- Internal. Disable lists for the current user.
- update
- Internal. Update a list belonging to the current user.
- This parameter is required.
- One of the following values: create, createentry, delete, deleteentry, setup, teardown, update
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
command=create
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Create a new list for the current user.
The user must have fewer than 100 (non-deleted) lists.
- name
List name. Required unless using batch creation.
- Cannot be longer than 255 bytes.
- description
List description.
- Cannot be longer than 767 bytes.
- batch
Batch data for creating multiple lists in a single request, in the form of a JSON array with one or more objects with name and (optionally) description fields.
- Create a new reading list.
- api.php?action=readinglists&command=create&name=dogs&description=Woof!&token=123ABC [open in sandbox]
- Create multiple new lists.
- api.php?action=readinglists&command=create&batch=%5B%7B%22name%22%3A%22dogs%22%2C%22description%22%3A%22Woof%21%22%7D%2C%7B%22name%22%3A%22cats%22%2C%22description%22%3A%22Meow%22%7D%5D&token=123ABC [open in sandbox]
command=createentry
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Add a new page to a list belonging to the current user.
List entries must be unique. Pages are not limited to the wiki where the API is accessed. The user must have fewer than 5000 (non-deleted) entries in the list.
- list
List ID.
- Type: integer
- project
Project name of the wiki hosting the page. Typically this is the domain name of the wiki or @local for the local wiki. Required unless doing batch creation.
- Cannot be longer than 255 bytes.
- title
Page title (including the localized namespace name). Required unless doing batch creation. Human-readable format (spaces not underscores) is recommended. The API treats titles as raw strings; normalization (such as title casing) is left to the clients.
- Cannot be longer than 383 bytes.
- batch
Batch data for creating multiple list entries (in the same list) in a single request, in the form of a JSON array with one or more objects with project and title fields.
- Add the page Dog from project en.wikipedia.org to the list with ID 33.
- api.php?action=readinglists&command=createentry&list=33&project=https%3A%2F%2Fen.wikipedia.org&title=Dog&token=123ABC [open in sandbox]
- Add multiple pages to a list.
- api.php?action=readinglists&command=createentry&list=33&batch=%5B%7B%22project%22%3A%22https%3A%5C%2F%5C%2Fen.wikipedia.org%22%2C%22title%22%3A%22Dog%22%7D%2C%7B%22project%22%3A%22https%3A%5C%2F%5C%2Fen.wikipedia.org%22%2C%22title%22%3A%22Cat%22%7D%5D&token=123ABC [open in sandbox]
command=delete
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Delete a list belonging to the current user.
Deleted lists remain available for some amount of time through the readinglists and readinglistentries modules (via the changedsince parameter). There is no way to undelete.
- list
List ID. Required unless doing batch deletion.
- Type: integer
- batch
Batch data for deleting multiple lists in a single request, in the form of a JSON array with one or more objects with a list field.
- Delete the reading list with ID 11.
- api.php?action=readinglists&command=delete&list=11&token=123ABC [open in sandbox]
- Delete multiple lists.
- api.php?action=readinglists&command=delete&batch=%5B%7B%22list%22%3A11%7D%2C%7B%22list%22%3A12%7D%5D&token=123ABC [open in sandbox]
command=deleteentry
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Delete a page from a list belonging to the current user.
- entry
Entry ID. Required unless doing batch deletion.
- Type: integer
- project
Project name of the wiki hosting the page. Must be used together with title. Deletes all entries matching the given project and title.
- Cannot be longer than 255 bytes.
- title
Page title to delete. Must be used together with project.
- Cannot be longer than 383 bytes.
- batch
Batch data for deleting multiple list entries in a single request, in the form of a JSON array with one or more objects with an entry field.
- Delete the list entry with ID 8.
- api.php?action=readinglists&command=deleteentry&entry=8&token=123ABC [open in sandbox]
- Delete multiple list entries.
- api.php?action=readinglists&command=deleteentry&batch=%5B%7B%22entry%22%3A8%7D%2C%7B%22entry%22%3A9%7D%5D&token=123ABC [open in sandbox]
- Delete all entries for the page Dog from project en.wikipedia.org.
- api.php?action=readinglists&command=deleteentry&project=https://en.wikipedia.org&title=Dog&token=123ABC [open in sandbox]
- Delete all entries for the page Garfield the Cat from project @local.
- api.php?action=readinglists&command=deleteentry&project=@local&title=Garfield%20the%20Cat&token=123ABC [open in sandbox]
command=setup
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Enable lists for the current user.
This command must be used before the user can do anything else with reading lists. Also creates a default list. To undo it, use teardown.
- Set up reading lists for the current user.
- api.php?action=readinglists&command=setup&token=123ABC [open in sandbox]
command=teardown
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Disable lists for the current user.
Removes all reading list data for the user. The setup command must be used if the user wishes to begin using reading lists again.
- Disable reading lists for the current user.
- api.php?action=readinglists&command=teardown&token=123ABC [open in sandbox]
command=update
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ReadingLists
- License: GPL-2.0-or-later
Update a list belonging to the current user.
- list
List ID. Required unless using batch update.
- Type: integer
- name
New list name. Either this or description is required unless doing batch update.
- Cannot be longer than 255 bytes.
- description
New list description.
- Cannot be longer than 767 bytes.
- batch
Batch data for updating multiple lists in a single request, in the form of a JSON array with one or more objects with list, name and description fields. Name and description are optional but at least one of them must be present.
- Change the name of the reading list with ID 42.
- api.php?action=readinglists&command=update&list=42&name=New+name&token=123ABC [open in sandbox]
- Update multiple lists.
- api.php?action=readinglists&command=update&batch=%5B%7B%22list%22%3A42%2C%22name%22%3A%22New+name%22%7D%2C%7B%22list%22%3A43%2C%22description%22%3A%22New+description%22%7D%5D&token=123ABC [open in sandbox]
action=removeauthenticationdata
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Remove authentication data for the current user.
- request
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=remove.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Attempt to remove the current user's data for FooAuthenticationRequest.
- api.php?action=removeauthenticationdata&request=FooAuthenticationRequest&token=123ABC [open in sandbox]
action=resetpassword
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Send a password reset email to a user.
- user
User being reset.
- Type: user, by username
Email address of the user being reset.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send a password reset email to user Example.
- api.php?action=resetpassword&user=Example&token=123ABC [open in sandbox]
- Send a password reset email for all users with email address [email protected].
- api.php?action=resetpassword&[email protected]&token=123ABC [open in sandbox]
action=review
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: FlaggedRevs (Pending Changes)
- License: GPL-2.0-or-later
Review a revision by approving or de-approving it.
- revid
The revision ID for which to set the flags.
- comment
Comment for the review.
- unapprove
If set, revision will be unapproved rather than approved.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Approve revision 12345 with comment "Ok"
- api.php?action=review&revid=12345&token=123AB&flag_accuracy=1&comment=Ok [open in sandbox]
action=revisiondelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Delete and undelete revisions.
- type
Type of revision deletion being performed.
- This parameter is required.
- One of the following values: archive, filearchive, logging, oldimage, revision
- target
Page title for the revision deletion, if required for the type.
- ids
Identifiers for the revisions to be deleted.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- hide
What to hide for each revision.
- Values (separate with | or alternative): comment, content, user
- show
What to unhide for each revision.
- Values (separate with | or alternative): comment, content, user
- suppress
Whether to suppress data from administrators as well as others.
- One of the following values: no, nochange, yes
- Default: nochange
- reason
Reason for the deletion or undeletion.
Tags to apply to the entry in the deletion log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Hide content for revision 12345 on the page Main Page.
- api.php?action=revisiondelete&target=Main%20Page&type=revision&ids=12345&hide=content&token=123ABC [open in sandbox]
- Hide all data on log entry 67890 with the reason BLP violation.
- api.php?action=revisiondelete&type=logging&ids=67890&hide=content|comment|user&reason=BLP%20violation&token=123ABC [open in sandbox]
action=rollback
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Undo the last edit to the page.
If the last user who edited the page made multiple edits in a row, they will all be rolled back.
- title
Title of the page to roll back. Cannot be used together with pageid.
- pageid
Page ID of the page to roll back. Cannot be used together with title.
- Type: integer
Tags to apply to the rollback.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- user
Name of the user whose edits are to be rolled back.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- summary
Custom edit summary. If empty, default summary will be used.
- Default: (empty)
- markbot
Mark the reverted edits and the revert as bot edits.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- token
A "rollback" token retrieved from action=query&meta=tokens
For compatibility, the token used in the web UI is also accepted.
- This parameter is required.
- Roll back the last edits to page Main Page by user Example.
- api.php?action=rollback&title=Main%20Page&user=Example&token=123ABC [open in sandbox]
- Roll back the last edits to page Main Page by IP user 192.0.2.5 with summary Reverting vandalism, and mark those edits and the revert as bot edits.
- api.php?action=rollback&title=Main%20Page&user=192.0.2.5&token=123ABC&summary=Reverting%20vandalism&markbot=1 [open in sandbox]
action=rsd
- Source: MediaWiki
- License: GPL-2.0-or-later
Export an RSD (Really Simple Discovery) schema.
- Export the RSD schema.
- api.php?action=rsd [open in sandbox]
action=sanitize-mapdata
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: Kartographer
- License: MIT
Performs data validation for Kartographer extension
- title
Title of page on which this GeoJSON is supposed to be located. If no title is provided, a dummy one will be used.
- Default: Dummy title (called from Kartographer\Api\ApiSanitizeMapData)
- text
GeoJSON to sanitize
- This parameter is required.
- Sanitize a GeoJSON blob
- api.php?action=sanitize-mapdata&text={"foo":"bar"} [open in sandbox]
action=scribunto-console
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: Scribunto
- License: GPL-2.0-or-later AND MIT
Internal module for servicing XHR requests from the Scribunto console.
- title
The title of the module to test.
- content
The new content of the module.
- session
Session token.
- Type: integer
- question
The next line to evaluate as a script.
- This parameter is required.
- clear
Set to clear the current session state.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=securepollauth
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: SecurePoll
- License: GPL-2.0-or-later
Allows a remote wiki to authenticate users before granting access to vote in the election.
- token
A token based on the user's login token.
- This parameter is required.
- id
The ID of the user who intends to vote.
- This parameter is required.
- Type: integer
- Authenticate user with ID 1, and login token 123ABC.
- api.php?action=securepollauth&token=123ABC&id=1&format=json [open in sandbox]
action=setglobalaccountstatus
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CentralAuth
- License: GPL-2.0-or-later
Hide or lock (or unhide or unlock) a global user account.
- user
User to change the status of.
- This parameter is required.
- locked
Change whether this user is locked or not.
- One of the following values: Can be empty, or lock, unlock
Change whether this user is not hidden, hidden from the global users list, or suppressed.
- One of the following values: Can be empty, or lists, suppressed
- reason
Reason for changing the user's status.
- statecheck
Optional MD5 of the expected current userid:username:hidden:locked. This is used to detect edit conflicts. The value of hidden must be an empty string if not hidden or the strings
listsorsuppressed. The value of locked must be 1 for locked, 0 for unlocked. Examples: 2128506:LeeSmith::0; 3839611:VandalGoblin:suppressed:1.- token
A "setglobalaccountstatus" token retrieved from action=query&meta=tokens
- This parameter is required.
- Lock the global account for User:Example with reason "Spam"
- api.php?action=setglobalaccountstatus&user=Example&locked=lock&hidden=&reason=Spam [open in sandbox]
- Unlock and suppress the global account for User:Example with reason "I can"
- api.php?action=setglobalaccountstatus&user=Example&locked=unlock&hidden=suppressed&reason=I%20can [open in sandbox]
action=setnotificationtimestamp
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Update the notification timestamp for watched pages.
This affects the highlighting of changed pages in the watchlist and history, and the sending of email when the "Email me when a page or a file on my watchlist is changed" preference is enabled.
- entirewatchlist
Work on all watched pages.
- Type: boolean (details)
- timestamp
Timestamp to which to set the notification timestamp.
- Type: timestamp (allowed formats)
- torevid
Revision to set the notification timestamp to (one page only).
- Type: integer
- newerthanrevid
Revision to set the notification timestamp newer than (one page only).
- Type: integer
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Reset the notification status for the entire watchlist.
- api.php?action=setnotificationtimestamp&entirewatchlist=&token=123ABC [open in sandbox]
- Reset the notification status for Main Page.
- api.php?action=setnotificationtimestamp&titles=Main%20Page&token=123ABC [open in sandbox]
- Set the notification timestamp for Main Page so all edits since 1 January 2012 are unviewed.
- api.php?action=setnotificationtimestamp&titles=Main%20Page×tamp=2012-01-01T00:00:00Z&token=123ABC [open in sandbox]
- Reset the notification status for pages in the User namespace.
- api.php?action=setnotificationtimestamp&generator=allpages&gapnamespace=2&token=123ABC [open in sandbox]
action=setpagelanguage
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the language of a page.
Changing the language of a page is not allowed on this wiki.
Enable $wgPageLanguageUseDB to use this action.
- title
Title of the page whose language you wish to change. Cannot be used together with pageid.
- pageid
Page ID of the page whose language you wish to change. Cannot be used together with title.
- Type: integer
- lang
Language code of the language to change the page to. Use default to reset the page to the wiki's default content language.
- This parameter is required.
- One of the following values: aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, aig, ak, aln, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, ban, ban-bali, bar, bbc, bbc-latn, bcc, bci, bcl, bdr, be, be-tarask, bew, bg, bgc, bgn, bh, bho, bi, bjn, blk, bm, bn, bo, bol, bpy, bqi, br, brh, bs, btm, bto, bug, bug-bugi, bxr, ca, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, chr, chy, ckb, co, cop, cps, cpx, cpx-hans, cpx-hant, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, default, dga, din, diq, dlg, dsb, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, eo, es, es-formal, et, eu, ext, fa, fat, ff, fi, fit, fj, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, kg, kge, khw, ki, kiu, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mdf, mg, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mui, mwl, my, myv, mzn, nah, nan, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, nia, nit, niu, nl, nl-informal, nmz, nn, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, qug, rgn, rif, rki, rm, rmc, rmy, rn, ro, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shn, shy, shy-latn, si, sjd, sje, sk, skr, skr-arab, sl, sli, sm, sma, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, ss, st, stq, sty, su, sv, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, ti, tig, tk, tl, tly, tn, to, tok, tpi, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, wa, wal, war, wls, wlx, wo, wuu, wuu-hans, wuu-hant, xal, xh, xmf, xsy, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zh, zh-cn, zh-hans, zh-hant, zh-hk, zh-mo, zh-my, zh-sg, zh-tw, zu
- reason
Reason for the change.
Change tags to apply to the log entry resulting from this action.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Change the language of the page Main Page to Basque.
- api.php?action=setpagelanguage&title=Main%20Page&lang=eu&token=123ABC [open in sandbox]
- Change the language of the page with ID 123 to the wiki's default content language.
- api.php?action=setpagelanguage&pageid=123&lang=default&token=123ABC [open in sandbox]
action=shortenurl
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: UrlShortener
- License: Apache-2.0
Shorten a long URL into a shorter one.
- url
URL to be shortened.
- This parameter is required.
- qrcode
Get a QR code. The linked URL will only be shortened if it is very long.
- Type: boolean (details)
- Get the short URL for https://en.wikipedia.org/wiki/Arctica.
- api.php?action=shortenurl&url=https%3A%2F%2Fen.wikipedia.org%2Fwiki%2FArctica [open in sandbox]
- Get a QR code for https://en.wikipedia.org/wiki/Arctica.
- api.php?action=shortenurl&url=https%3A%2F%2Fen.wikipedia.org%2Fwiki%2FArctica&qrcode=1 [open in sandbox]
action=sitematrix (sm)
- This module requires read rights.
- Source: SiteMatrix
- License: GPL-2.0-or-later
Get Wikimedia sites list.
The code (technically dbname/wikiid) is either the language code + project code for content projects or the subdomain + main domain for all the others.
- smtype
Filter the Site Matrix by type:
- special
- One off and multilingual Wikimedia projects.
- language
- Wikimedia projects under this language code.
- Values (separate with | or alternative): language, special
- Default: special|language
- smstate
Filter the Site Matrix by wiki state.
- Values (separate with | or alternative): all, closed, fishbowl, nonglobal, private
- Default: all
- smlangprop
Which information about a language to return.
- Values (separate with | or alternative): code, dir, localname, name, site
- Default: code|name|site|dir|localname
- smsiteprop
Which information about a site to return.
- Values (separate with | or alternative): code, dbname, lang, sitename, url
- Default: url|dbname|code|sitename
- smlimit
Maximum number of results.
- Type: integer or max
- The value must be between 1 and 5,000.
- Default: 5000
- smcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show the site matrix
- api.php?action=sitematrix [open in sandbox]
action=spamblacklist
- This module requires read rights.
- Source: SpamBlacklist
- License: GPL-2.0-or-later
Validate one or more URLs against the spam block list.
- url
URLs to validate against the block list.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Check two URLs against the block list
- api.php?action=spamblacklist&url=http://www.example.com/|http://www.example.org/ [open in sandbox]
action=stabilize
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: FlaggedRevs (Pending Changes)
- License: GPL-2.0-or-later
Configure review-protection settings for a page.
- protectlevel
The review-protection level.
- One of the following values: autoconfirmed, none
- Default: none
- expiry
Review-protection expiry.
- Default: infinite
- reason
Reason.
- Default: (empty)
- title
Title of the page to be review-protected.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Remove review-protection from Test
- api.php?action=stabilize&title=Test&protectlevel=none&reason=Test&token=123ABC [open in sandbox]
action=stashedit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Prepare an edit in shared cache.
This is intended to be used via AJAX from the edit form to improve the performance of the page save.
- title
Title of the page being edited.
- This parameter is required.
- section
Section identifier. 0 for the top section, new for a new section.
- sectiontitle
The title for a new section.
- text
Page content.
- stashedtexthash
Page content hash from a prior stash to use instead.
- summary
Change summary.
- Default: (empty)
- contentmodel
Content model of the new content.
- This parameter is required.
- One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
- contentformat
Content serialization format used for the input text.
- This parameter is required.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- baserevid
Revision ID of the base revision.
- This parameter is required.
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=streamconfigs
- This module requires read rights.
- Source: EventStreamConfig
- License: GPL-2.0-or-later
Exposes event stream config. Returns only format=json with formatversion=2.
- streams
List of streams to get config for
- Separate values with | or alternative.
- Maximum number of values is 250 (500 for clients that are allowed higher limits).
- constraints
Filter results for stream config entries that have these settings
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- all_settings
- Deprecated.
Include all settings in stream config results. Deprecated since 1.41. All settings are included by default.
- Type: boolean (details)
- Get stream configs for a list of streams
- api.php?action=streamconfigs&streams=mediawiki.page-view|mediawiki.button-click [open in sandbox]
- Get stream config for streams with all settings
- api.php?action=streamconfigs&streams=mediawiki.button-click [open in sandbox]
- Get stream config for streams that have settings matching these constraints
- api.php?action=streamconfigs&streams=mediawiki.button-click&constraints=event_service_name=eventgate-main [open in sandbox]
action=strikevote
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: SecurePoll
- License: GPL-2.0-or-later
Allows admins to strike or unstrike a vote.
- option
Which action to take: strike or unstrike a vote.
- strike
- Strike a vote (remove it from the count).
- unstrike
- Unstrike a vote (restore it to the count).
- This parameter is required.
- One of the following values: strike, unstrike
- reason
The reason for striking or unstriking the vote.
- This parameter is required.
- voteid
The ID of the vote to be struck or unstruck.
- This parameter is required.
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Strike vote 1, giving the reason duplication.
- api.php?action=strikevote&option=strike&reason=duplication&voteid=1&token=123ABC [open in sandbox]
- Unstrike vote 1, giving the reason mistake.
- api.php?action=strikevote&option=unstrike&reason=mistake&voteid=1&token=123ABC [open in sandbox]
action=sxdelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Delete the draft section translation and its parallel corpora from database.
- sectiontranslationid
The section translation id associated with the draft section translation.
- This parameter is required.
- Type: integer
- translationid
The translation id associated with the draft section translation.
- This parameter is required.
- Type: integer
- sectionid
The id of the section of the draft section translation.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Delete a draft associated with given translation id and section id.
- api.php?action=sxdelete&translationid=1§ionid=100_20 [open in sandbox]
action=sxsave
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: ContentTranslation
- License: GPL-2.0-or-later
Save the draft section translation and store the parallel corpora
- sourcelanguage
The source language code.
- This parameter is required.
- targetlanguage
The target language code.
- This parameter is required.
- sourcetitle
The title of the source page.
- This parameter is required.
- targettitle
The title of the target page.
- This parameter is required.
- content
JSON-encoded section data. Each section is an object and has the following keys: content, sectionId, origin, validate
- This parameter is required.
- sourcerevision
The source page revision id.
- This parameter is required.
- Type: integer
- sourcesectiontitle
The title of the source section.
- This parameter is required.
- targetsectiontitle
The title of the target section.
- This parameter is required.
- sectionid
The page section id.
- This parameter is required.
- issandbox
Use a sandbox title for translation.
- Type: boolean (details)
- progress
The progress of the translation.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=tag
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Add or remove change tags from individual revisions or log entries.
- rcid
One or more recent changes IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revid
One or more revision IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- logid
One or more log entry IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- add
Tags to add. Only manually defined tags can be added.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- remove
Tags to remove. Only tags that are either manually defined or completely undefined can be removed.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- reason
Reason for the change.
- Default: (empty)
Tags to apply to the log entry that will be created as a result of this action.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Add the vandalism tag to revision ID 123 without specifying a reason
- api.php?action=tag&revid=123&add=vandalism&token=123ABC [open in sandbox]
- Remove the spam tag from log entry ID 123 with the reason Wrongly applied
- api.php?action=tag&logid=123&remove=spam&reason=Wrongly+applied&token=123ABC [open in sandbox]
action=templatedata
- This module requires read rights.
- Source: TemplateData
- License: GPL-2.0-or-later
Fetch data stored by the TemplateData extension.
- includeMissingTitles
Return data about titles even if they are missing or lack TemplateData. By default titles are only returned if they exist and have TemplateData.
- Type: boolean (details)
- doNotIgnoreMissingTitles
- Deprecated.
Return data about titles even if they are missing or lack TemplateData. By default (for backwards compatibility) titles are only returned if they exist and have TemplateData.
- Type: boolean (details)
- lang
Return localized values in this language. By default all available translations are returned.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Return TemplateData for Template:Foobar, with results if the template does not exist or exists but has no TemplateData
- api.php?action=templatedata&titles=Template:Foobar&includeMissingTitles=1 [open in sandbox]
- Return TemplateData for Template:Phabricator, with no results if the template does not exist or exists but has no TemplateData
- api.php?action=templatedata&titles=Template:Phabricator [open in sandbox]
action=thank
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Thanks
- License: MIT
Send a thank-you notification to an editor.
- rev
Revision ID to thank someone for. This or 'log' must be provided.
- Type: integer
- The value must be no less than 1.
- log
Log ID to thank someone for. This or 'rev' must be provided.
- Type: integer
- The value must be no less than 1.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- source
A short string describing the source of the request, for example diff or history.
- Send thanks for revision ID 456, with the source being a diff page
- api.php?action=thank&revid=456&source=diff&token=123ABC [open in sandbox]
action=timedtext
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: TimedMediaHandler
- License: GPL-2.0-or-later
Provides timed text content for usage by <track> elements
- title
The media file title for which to retrieve timed text
- pageid
The pageid of the media file for which to retrieve timed text
- Type: integer
- trackformat
The file format in which to return timed text
- This parameter is required.
- One of the following values: srt, vtt
- lang
The language of the timed text to retrieve
- Fetch an SRT subtitle file in German for the file Example.ogv
- api.php?action=timedtext&title=File:Example.ogv&lang=de&trackformat=vtt [open in sandbox]
action=titleblacklist (tb)
- This module requires read rights.
- Source: TitleBlacklist
- License: GPL-2.0-or-later
Validate a page title, filename, or username against the TitleBlacklist.
- tbtitle
The string to validate against the blacklist.
- This parameter is required.
- tbaction
The action to be checked.
- One of the following values: create, createpage, createtalk, edit, move, new-account, upload
- Default: edit
- tbnooverride
Don't try to override the titleblacklist.
- Type: boolean (details)
- Check whether Foo is blacklisted
- api.php?action=titleblacklist&tbtitle=Foo [open in sandbox]
- Check whether Bar is blacklisted for editing
- api.php?action=titleblacklist&tbtitle=Bar&tbaction=edit [open in sandbox]
action=torblock
- This module requires read rights.
- Source: TorBlock
- License: GPL-2.0-or-later
Check if an IP address is blocked as a Tor exit node.
- ip
The IP address to check.
- This parameter is required.
- Check if the IP address 192.0.2.18 is blocked as a Tor exit node.
- api.php?action=torblock&ip=192.0.2.18 [open in sandbox]
action=transcodereset
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: TimedMediaHandler
- License: GPL-2.0-or-later
Users with the 'transcode-reset' right can reset and re-run a transcode job.
- title
The media file title.
- This parameter is required.
- transcodekey
The transcode key you wish to reset. Fetch from action=query&prop=transcodestatus.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Reset all transcodes for File:Clip.webm
- api.php?action=transcodereset&title=File:Clip.webm&token=123ABC [open in sandbox]
- Reset the '360_560kbs.webm' transcode key for File:Clip.webm
- api.php?action=transcodereset&title=File:Clip.webm&transcodekey=360_560kbs.webm&token=123ABC [open in sandbox]
action=ulslocalization
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: UniversalLanguageSelector
- License: GPL-2.0-or-later OR MIT
Get the localization of ULS in the given language.
- language
Language code.
- This parameter is required.
- Get Tamil localization
- api.php?action=ulslocalization&language=ta [open in sandbox]
- Get Hindi localization
- api.php?action=ulslocalization&language=hi [open in sandbox]
action=ulssetlang
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: UniversalLanguageSelector
- License: GPL-2.0-or-later OR MIT
Update user's preferred interface language.
- languagecode
The preferred language code.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=unblock
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Unblock a user.
- id
ID of the block to unblock (obtained through list=blocks). Cannot be used together with user.
- Type: integer
- user
User to unblock. Cannot be used together with id.
- Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- reason
Reason for unblock.
- Default: (empty)
Change tags to apply to the entry in the block log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- watchuser
Watch the user's or IP address's user and talk pages.
- Type: boolean (details)
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Unblock block ID #105.
- api.php?action=unblock&id=105 [open in sandbox]
- Unblock user Bob with reason Sorry Bob.
- api.php?action=unblock&user=Bob&reason=Sorry%20Bob [open in sandbox]
action=undelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Undelete revisions of a deleted page.
A list of deleted revisions (including timestamps) can be retrieved through prop=deletedrevisions, and a list of deleted file IDs can be retrieved through list=filearchive.
- title
Title of the page to undelete.
- This parameter is required.
- reason
Reason for restoring.
- Default: (empty)
Change tags to apply to the entry in the deletion log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- timestamps
Timestamps of the revisions to undelete. If both timestamps and fileids are empty, all will be undeleted.
- Type: list of timestamps (allowed formats)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- fileids
IDs of the file revisions to restore. If both timestamps and fileids are empty, all will be restored.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- undeletetalk
Undelete all revisions of the associated talk page, if any.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=unlinkaccount
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Remove a linked third-party account from the current user.
- request
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=unlink.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Attempt to remove the current user's link for the provider associated with FooAuthenticationRequest.
- api.php?action=unlinkaccount&request=FooAuthenticationRequest&token=123ABC [open in sandbox]
action=upload
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Upload a file, or get the status of pending uploads.
Several methods are available:
- Upload file contents directly, using the file parameter.
- Upload the file in pieces, using the filesize, chunk, and offset parameters.
- Have the MediaWiki server fetch a file from a URL, using the url parameter.
- Complete an earlier upload that failed due to warnings, was uploaded in pieces, or stored otherwise in the upload stash, using the filekey parameter.
Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending the file or chunk.
- filename
Target filename.
- comment
Upload comment. Also used as the initial page text for new files if text is not specified.
- Default: (empty)
Change tags to apply to the upload log entry and file page revision.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- text
Initial page text for new files.
- watch
- Deprecated.
Watch the page.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, watch
- Default: preferences
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- ignorewarnings
Ignore any warnings.
- Type: boolean (details)
- file
File contents.
- Must be posted as a file upload using multipart/form-data.
- url
URL to fetch the file from.
- filekey
Key that identifies a previous upload that was stashed temporarily.
- sessionkey
- Deprecated.
Same as filekey, maintained for backward compatibility.
- stash
If set, the server will stash the file temporarily instead of adding it to the repository.
- Type: boolean (details)
- filesize
Filesize of entire upload.
- Type: integer
- The value must be between 0 and 5,368,709,120.
- offset
Offset of chunk in bytes.
- Type: integer
- The value must be no less than 0.
- chunk
Chunk contents.
- Must be posted as a file upload using multipart/form-data.
- async
Make potentially large file operations asynchronous when possible.
- Type: boolean (details)
- checkstatus
Only fetch the upload status for the given file key.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Upload from a URL.
- api.php?action=upload&filename=Wiki.png&url=http%3A//upload.wikimedia.org/wikipedia/en/b/bc/Wiki.png&token=123ABC [open in sandbox]
- Complete an upload that failed due to warnings.
- api.php?action=upload&filename=Wiki.png&filekey=filekey&ignorewarnings=1&token=123ABC [open in sandbox]
action=userrights
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change a user's group membership.
- user
User.
- Type: user, by any of username and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- add
Add the user to these groups, or if they are already a member, update the expiry of their membership in that group.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- expiry
Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: infinite
- remove
Remove the user from these groups.
- Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
- reason
Reason for the change.
- Default: (empty)
- token
A "userrights" token retrieved from action=query&meta=tokens
For compatibility, the token used in the web UI is also accepted.
- This parameter is required.
Change tags to apply to the entry in the user rights log.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
- watchuser
Watch the user's user and talk pages.
- Type: boolean (details)
- watchlistexpiry
Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.
- Type: expiry (details)
- Add user FooBot to group bot, and remove from groups sysop and bureaucrat.
- api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
- Add the user with ID 123 to group bot, and remove from groups sysop and bureaucrat.
- api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
- Add user SometimeSysop to group sysop for 1 month.
- api.php?action=userrights&user=SometimeSysop&add=sysop&expiry=1%20month&token=123ABC [open in sandbox]
action=validatepassword
- This module requires read rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Validate a password against the wiki's password policies.
Validity is reported as Good if the password is acceptable, Change if the password may be used for login but must be changed, or Invalid if the password is not usable.
- password
Password to validate.
- This parameter is required.
- user
Username, for use when testing account creation. The named user must not exist.
- Type: user, by any of username and user ID (e.g. "#12345")
Email address, for use when testing account creation.
- realname
Real name, for use when testing account creation.
- Validate the password foobar for the current user.
- api.php?action=validatepassword&password=foobar [open in sandbox]
- Validate the password qwerty for creating user Example.
- api.php?action=validatepassword&password=querty&user=Example [open in sandbox]
action=visualeditor
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: VisualEditor
- License: MIT
Returns HTML5 for a page from the Parsoid service.
- page
The page to perform actions on.
- This parameter is required.
- badetag
If RESTBase query returned a seemingly invalid ETag, pass it here for logging purposes.
- format
The format of the output.
- One of the following values: json, jsonfm
- Default: jsonfm
- paction
Action to perform.
- This parameter is required.
- One of the following values: metadata, parse, parsefragment, templatesused, wikitext
- wikitext
Wikitext to send to Parsoid to convert to HTML (paction=parsefragment).
- section
The section on which to act.
- stash
When saving, set this true if you want to use the stashing API.
- Type: boolean (details)
- oldid
The revision number to use (defaults to latest revision).
- Type: integer
- editintro
Edit intro to add to notices.
- pst
Pre-save transform wikitext before sending it to Parsoid (paction=parsefragment).
- Type: boolean (details)
- preload
The page to use content from if the fetched page has no content yet.
- preloadparams
Parameters to substitute into the preload page, if present.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
action=visualeditoredit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: VisualEditor
- License: MIT
Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- paction
Action to perform.
- This parameter is required.
- One of the following values: diff, save, serialize, serializeforcache
- page
The page to perform actions on.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- wikitext
The wikitext to act with.
- section
The section on which to act.
- sectiontitle
Title for new section.
- basetimestamp
When saving, set this to the timestamp of the revision that was edited. Used to detect edit conflicts.
- Type: timestamp (allowed formats)
- starttimestamp
When saving, set this to the timestamp of when the page was loaded. Used to detect edit conflicts.
- Type: timestamp (allowed formats)
- oldid
The revision number to use. Defaults to latest revision.
- Type: integer
- minor
Flag for minor edit.
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- html
HTML to send to Parsoid in exchange for wikitext.
- etag
ETag to send.
- summary
Edit summary.
- captchaid
Captcha ID (when saving with a captcha response).
- captchaword
Answer to the captcha (when saving with a captcha response).
- cachekey
Use the result of a previous serializeforcache request with this key. Overrides html.
- nocontent
Omit the HTML content of the new revision in the response.
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
Change tags to apply to the edit.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- plugins
Plugins associated with the API request.
- ge-task-link-recommendation
- Use when saving a GrowthExperiments "Add a link" structured edit.
- ge-task-revise-tone
- Use when saving a GrowthExperiments "Revise Tone" structured edit.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- data-{plugin}
Arbitrary data sent by a plugin with the API request.
- For the ge-task-link-recommendation plugin
-
A JSON string of an object with these keys:
- acceptedTargets: (optional) Array with the titles of pages, the recommended link to which was accepted by the user.
- rejectedTargets: (optional) Array with the titles of pages, the recommended link to which was rejected by the user.
- skippedTargets: (optional) Array with the titles of pages, the recommended link to which was skipped (ignored) by the user.
- For the ge-task-revise-tone plugin
- No data should be included for this plugin.
- This is a templated parameter. When making the request, {plugin} in the parameter's name should be replaced with values of plugins.
- mobileformat
Return parse output in a format suitable for mobile devices.
- Type: boolean (details)
action=watch
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Add or remove pages from the current user's watchlist.
- title
- Deprecated.
The page to (un)watch. Use titles instead.
- expiry
Expiry timestamp to be applied to all given pages. Omit this parameter entirely to leave any current expiries unchanged.
- Type: expiry (details)
- labels
Label IDs to assign to the pages being watched. This will replace all existing labels on the pages with the ones specified.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unwatch
If set the page will be unwatched rather than watched.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- geosearch
- Returns pages having coordinates that are located in a certain area.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- mostviewed
- Lists the most viewed pages (based on last day's pageview count).
- oldreviewedpages
- Enumerates pages that have changes pending review.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- projectpages
- List all pages associated with one or more projects.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- growthtasks
- Internal. Get task recommendations suitable for newcomers.
- readinglistentries
- Internal. List the pages of a certain list.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- token
A "watch" token retrieved from action=query&meta=tokens
- This parameter is required.
- Watch the page Main Page.
- api.php?action=watch&titles=Main%20Page&token=123ABC [open in sandbox]
- Watch the pages Main Page, Foo, and Bar for one month.
- api.php?action=watch&titles=Main%20Page|Foo|Bar&expiry=1%20month&token=123ABC [open in sandbox]
- Watch the page Main Page with labels 1 and 2.
- api.php?action=watch&titles=Main%20Page&labels=1%7C2&token=123ABC [open in sandbox]
- Unwatch the page Main Page.
- api.php?action=watch&titles=Main%20Page&unwatch=&token=123ABC [open in sandbox]
- Watch the first few pages in the main namespace.
- api.php?action=watch&generator=allpages&gapnamespace=0&token=123ABC [open in sandbox]
action=webapp-manifest
- This module requires read rights.
- Source: MobileFrontend
- License: GPL-2.0-or-later
Returns a webapp manifest.
action=webauthn
- This module requires read rights.
- Source: OATHAuth
- License: GPL-2.0-or-later AND GPL-3.0-or-later
API Module to communicate between server and client during registration/authentication process.
- func
Name of the requested function to be executed.
- getAuthInfo
- Authentication information.
- getRegisterInfo
- Registration information.
- register
- Register a new WebAuthn credential for the current user.
- This parameter is required.
- One of the following values: getAuthInfo, getRegisterInfo, register
- passkeyMode
Whether the key being registered is in passkey mode. (Only for getRegisterInfo.)
- Type: boolean (details)
- credential
JSON-encoded WebAuthn credential response from the browser.
- friendlyname
Friendly name for the new credential.
action=wikilove
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikiLove
- License: MIT
Give WikiLove to another user.
WikiLove is a positive message posted to a user's talk page through a convenient interface with preset or locally defined templates. This action adds the specified wikitext to a certain talk page. For statistical purposes, the type and other data are logged.
- title
Full pagename of the user page or user talk page of the user to send WikiLove to.
- This parameter is required.
- text
Raw wikitext to add in the new section.
- This parameter is required.
- message
Actual message the user has entered, for logging purposes.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- subject
Subject header of the new section.
- This parameter is required.
- type
Type of WikiLove (for statistics); this corresponds with a type selected in the menu, and optionally a subtype after that (e.g. as in "The Original Barnstar" or "A kitten for you!").
Content of the optional email message to send to the user. A warning will be returned if the user cannot be emailed. WikiLove will be sent to the user's talk page either way.
Change tags to apply to the revision.
- Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
action=wikimediaeventsblockededit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: WikimediaEvents
- License: GPL-2.0-or-later
Log information about blocked edit attempts
- page
A page on which an edit attempt was made
- This parameter is required.
- interface
The interface which was used to edit
- This parameter is required.
- One of the following values: discussiontools, mobilefrontend, other, visualeditor, wikieditor
- platform
The platform which was used to edit
- This parameter is required.
- One of the following values: desktop, mobile
action=wikimediaeventshcaptchaeditattempt
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: WikimediaEvents
- License: GPL-2.0-or-later
Log edit diff when hCaptcha challenge is shown but edit is incomplete
- title
Page title
- This parameter is required.
- proposed_content
Proposed content text (max 8KB)
- This parameter is required.
- editing_session_id
Editing session ID
- This parameter is required.
- revision_id
Revision ID of the page being edited
- This parameter is required.
- Type: integer
format=json
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in JSON format.
- callback
If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.
- utf8
If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.
- Type: boolean (details)
- ascii
If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.
- Type: boolean (details)
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the JSON format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=json [open in sandbox]
format=jsonfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in JSON format (pretty-print in HTML).
- wrappedhtml
Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.
- Type: boolean (details)
- callback
If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.
- utf8
If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.
- Type: boolean (details)
- ascii
If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.
- Type: boolean (details)
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the JSON format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=jsonfm [open in sandbox]
format=none
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output nothing.
- Return the query result in the NONE format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=none [open in sandbox]
format=rawfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data, including debugging elements, in JSON format (pretty-print in HTML).
- wrappedhtml
Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.
- Type: boolean (details)
- Return the query result in the RAW format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=rawfm [open in sandbox]
format=xml
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in XML format.
- includexmlnamespace
If specified, adds an XML namespace.
- Type: boolean (details)
- Return the query result in the XML format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=xml [open in sandbox]
format=xmlfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in XML format (pretty-print in HTML).
- Return the query result in the XML format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=xmlfm [open in sandbox]
// copied from User:DinhHuy2010/API
Content Disclaimer
Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.
- The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
- There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
- It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
- Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
- Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.