User:RememberOrwell/API

User:RememberOrwell/API/Header

Main module

Specify the action to perform, the format of the response, and options that apply to all API modules.

Specific parameters:
action

Which action to perform. This parameter should be sent as part of the request URL (not the POST body) for ease of use in debugging, analytics, and request routing or filtering.

abusefiltercheckmatch
Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
abusefilterchecksyntax
Check syntax of an AbuseFilter filter.
abusefilterevalexpression
Evaluates an AbuseFilter expression.
abusefilterunblockautopromote
Unblocks a user from receiving autopromotions due to an abusefilter consequence.
abuselogprivatedetails
View private details of an AbuseLog entry.
acquiretempusername
Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
antispoof
Check a username against AntiSpoof's normalisation checks.
block
Block a user.
centralauthtoken
Fetch a centralauthtoken for making an authenticated request to an attached wiki.
centralnoticecdncacheupdatebanner
Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
centralnoticechoicedata
Get data needed to choose a banner for a given project and language
centralnoticequerycampaign
Get all configuration settings for a campaign.
changeauthenticationdata
Change authentication data for the current user.
changecontentmodel
Change the content model of a page
checktoken
Check the validity of a token from action=query&meta=tokens.
clearhasmsg
Clears the hasmsg flag for the current user.
clientlogin
Log in to the wiki using the interactive flow.
communityconfigurationedit
Change the content of a configuration provider in Community configuration
compare
Get the difference between two pages.
createaccount
Create a new user account.
createlocalaccount
Forcibly create a local account. The central account must exist.
cxdelete
Delete a draft translation created using the Content Translation extension.
cxtoken
Get JWT tokens to authenticate with cxserver.
delete
Delete a page.
deleteglobalaccount
Delete a global user.
discussiontoolsedit
Post a message on a discussion page.
discussiontoolsfindcomment
Find a comment by its ID or name.
discussiontoolsgetsubscriptions
Get the subscription statuses of given topics.
discussiontoolssubscribe
Subscribe (or unsubscribe) to receive notifications about a topic.
discussiontoolsthank
Send a public thank-you notification for a comment.
echocreateevent
Manually trigger a notification to a user
echomarkread
Mark notifications as read for the current user.
echomarkseen
Mark notifications as seen for the current user.
echomute
Mute or unmute notifications from certain users or pages.
edit
Create and edit pages.
editmassmessagelist
Edit a mass message delivery list.
emailuser
Email a user.
expandtemplates
Expands all templates within wikitext.
featuredfeed
Returns a featured content feed.
feedcontributions
Returns a user's contributions feed.
feedrecentchanges
Returns a recent changes feed.
feedwatchlist
Returns a watchlist feed.
filerevert
Revert a file to an old version.
flagconfig
Get basic information about review flag configuration for this site.
globalblock
Globally block or unblock a user.
globalpreferenceoverrides
Change local overrides for global preferences for the current user.
globalpreferences
Change global preferences of the current user.
globaluserrights
Add/remove a user to/from global groups.
growthmanagementorlist
Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
growthmentordashboardupdatedata
Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
growthsetmenteestatus
Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
growthsetmentor
Set user's mentor. Change will be publicly logged.
growthstarmentee
Mark or unmark a mentee as starred by current user (stored privately and not logged)
help
Display help for the specified modules.
homepagequestionstore
Obtain formatted questions posted via homepage modules
imagerotate
This module has been disabled.
import
Import a page from another wiki, or from an XML file.
jsonconfig
Allows direct access to JsonConfig subsystem.
languagesearch
Search for language names in any script.
linkaccount
Link an account from a third-party provider to the current user.
login
Log in and get authentication cookies.
logout
Log out and clear session data.
managetags
Perform management tasks relating to change tags.
massmessage
Send a message to a list of pages.
mergehistory
Merge page histories.
move
Move a page.
opensearch
Search the wiki using the OpenSearch protocol.
options
Change preferences of the current user.
pagetriageaction
Mark an article as reviewed or unreviewed.
pagetriagelist
Get a list of page IDs for building a PageTriage queue.
pagetriagestats
Get the stats for page triage.
pagetriagetagcopyvio
Tag a revision as a likely copyright violation.
pagetriagetagging
Add tags to an article.
paraminfo
Obtain information about API modules.
parse
Parses content and returns parser output.
patrol
Patrol a page or revision.
protect
Change the protection level of a page.
purge
Purge the cache for the given titles.
query
Fetch data from and about MediaWiki.
removeauthenticationdata
Remove authentication data for the current user.
resetpassword
Send a password reset email to a user.
review
Review a revision by approving or de-approving it.
revisiondelete
Delete and undelete revisions.
rollback
Undo the last edit to the page.
rsd
Export an RSD (Really Simple Discovery) schema.
setglobalaccountstatus
Hide or lock (or unhide or unlock) a global user account.
setnotificationtimestamp
Update the notification timestamp for watched pages.
setpagelanguage
Change the language of a page.
shortenurl
Shorten a long URL into a shorter one.
sitematrix
Get Wikimedia sites list.
spamblacklist
Validate one or more URLs against the spam block list.
stabilize
Configure review-protection settings for a page.
streamconfigs
Exposes event stream config. Returns only format=json with formatversion=2.
strikevote
Allows admins to strike or unstrike a vote.
sxdelete
Delete the draft section translation and its parallel corpora from database.
tag
Add or remove change tags from individual revisions or log entries.
templatedata
Fetch data stored by the TemplateData extension.
thank
Send a thank-you notification to an editor.
titleblacklist
Validate a page title, filename, or username against the TitleBlacklist.
torblock
Check if an IP address is blocked as a Tor exit node.
transcodereset
Users with the 'transcode-reset' right can reset and re-run a transcode job.
unblock
Unblock a user.
undelete
Undelete revisions of a deleted page.
unlinkaccount
Remove a linked third-party account from the current user.
upload
Upload a file, or get the status of pending uploads.
userrights
Change a user's group membership.
validatepassword
Validate a password against the wiki's password policies.
watch
Add or remove pages from the current user's watchlist.
webapp-manifest
Returns a webapp manifest.
webauthn
API Module to communicate between server and client during registration/authentication process.
wikilove
Give WikiLove to another user.
bouncehandler
Internal. Receive a bounce email and process it to handle the failing recipient.
categorytree
Internal. Internal module for the CategoryTree extension.
chartinfo
Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
cirrus-check-sanity
Internal. Reports on the correctness of a range of page ids in the search index
cirrus-config-dump
Internal. Dump of CirrusSearch configuration.
cirrus-profiles-dump
Internal. Dump of CirrusSearch profiles for this wiki.
cirrus-schema-dump
Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
codemirror-validate
Internal. Check for validation errors in the given content
collection
Internal. API module for performing various operations on a wiki user's collection.
cspreport
Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
cxcheckunreviewed
Internal. Check if any fast, unreviewed translation has been published recently for the current user.
cxfavoritesuggestions
Internal. Add or remove a favorite suggestion to the current user's list.
cxpublish
Internal. Save a page created using the Content Translation extension.
cxpublishsection
Internal. Save a section created using the Content Translation extension's section translation feature.
cxsave
Internal. This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.
cxsplit
Internal. Create and save a section translation to database, for every translated section of the given article translation
discussiontoolscompare
Internal. Get information about comment changes between two page revisions.
discussiontoolspageinfo
Internal. Returns metadata required to initialize the discussion tools.
discussiontoolspreview
Internal. Preview a message on a discussion page.
echopushsubscriptions
Internal. Manage push subscriptions for the current user.
editcheckreferenceurl
Internal. Check the status of a URL for use as a reference.
fancycaptchareload
Internal. Get a new FancyCaptcha.
growthinvalidateimagerecommendation
Internal. Invalidate an image recommendation.
growthinvalidatepersonalizedpraisesuggestion
Internal. Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
growthinvalidaterevisetonerecommendation
Internal. Drop a 'Revise Tone' recommendation for a given page.
helppanelquestionposter
Internal. Handle questions posted via the help panel for the current user.
jsondata
Internal. Retrieve localized JSON data.
jsontransform
Internal. Retrieve JSON data transformed by a Lua function.
parser-migration
Internal. Parse a page with two different parser configurations.
readinglists
Internal. Reading list write operations.
sanitize-mapdata
Internal. Performs data validation for Kartographer extension
scribunto-console
Internal. Internal module for servicing XHR requests from the Scribunto console.
securepollauth
Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
stashedit
Internal. Prepare an edit in shared cache.
sxsave
Internal. Save the draft section translation and store the parallel corpora
timedtext
Internal. Provides timed text content for usage by <track> elements
ulslocalization
Internal. Get the localization of ULS in the given language.
ulssetlang
Internal. Update user's preferred interface language.
visualeditor
Internal. Returns HTML5 for a page from the Parsoid service.
visualeditoredit
Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
wikimediaeventsblockededit
Internal. Log information about blocked edit attempts
wikimediaeventshcaptchaeditattempt
Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, cxdelete, cxtoken, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, flagconfig, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, growthmanagementorlist, growthmentordashboardupdatedata, growthsetmenteestatus, growthsetmentor, growthstarmentee, help, homepagequestionstore, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, pagetriageaction, pagetriagelist, pagetriagestats, pagetriagetagcopyvio, pagetriagetagging, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, review, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, stabilize, streamconfigs, strikevote, sxdelete, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, wikilove, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, cxcheckunreviewed, cxfavoritesuggestions, cxpublish, cxpublishsection, cxsave, cxsplit, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, echopushsubscriptions, editcheckreferenceurl, fancycaptchareload, growthinvalidateimagerecommendation, growthinvalidatepersonalizedpraisesuggestion, growthinvalidaterevisetonerecommendation, helppanelquestionposter, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, sxsave, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
Default: help
format

The format of the output.

json
Output data in JSON format.
jsonfm
Output data in JSON format (pretty-print in HTML).
none
Output nothing.
rawfm
Output data, including debugging elements, in JSON format (pretty-print in HTML).
xml
Output data in XML format.
xmlfm
Output data in XML format (pretty-print in HTML).
One of the following values: json, jsonfm, none, rawfm, xml, xmlfm
Default: jsonfm
maxlag

Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.

Type: integer
smaxage

Set the s-maxage HTTP cache control header to this many seconds. Errors are never cached.

Type: integer
The value must be no less than 0.
Default: 0
maxage

Set the max-age HTTP cache control header to this many seconds. Errors are never cached.

Type: integer
The value must be no less than 0.
Default: 0
assert

Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.

One of the following values: anon, bot, user
assertuser

Verify the current user is the named user.

Type: user, by any of username and Temporary user
requestid

Any value given here will be included in the response. May be used to distinguish requests.

servedby

Include the hostname that served the request in the results.

Type: boolean (details)
curtimestamp

Include the current timestamp in the result.

Type: boolean (details)
responselanginfo

Include the languages used for uselang and errorlang in the result.

Type: boolean (details)
origin

When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).

For authenticated requests, this must match one of the origins in the Origin header exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match the Origin header, a 403 response will be returned. If this parameter matches the Origin header and the origin is allowed, the Access-Control-Allow-Origin and Access-Control-Allow-Credentials headers will be set.

For non-authenticated requests, specify the value *. This will cause the Access-Control-Allow-Origin header to be set, but Access-Control-Allow-Credentials will be false and all user-specific data will be restricted.

crossorigin

When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of origin=* to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).

Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.

Type: boolean (details)
uselang

Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.

Default: user
variant

Variant of the language. Only works if the base language supports variant conversion.

errorformat

Format to use for warning and error text output

plaintext
Wikitext with HTML tags removed and entities replaced.
wikitext
Unparsed wikitext.
html
HTML
raw
Message key and parameters.
none
No text output, only the error codes.
bc
Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
One of the following values: bc, html, none, plaintext, raw, wikitext
Default: bc
errorlang

Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.

Default: uselang
errorsuselocal

If given, error texts will use locally-customized messages from the MediaWiki namespace.

Type: boolean (details)
centralauthtoken

When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).

On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.

action=abusefiltercheckmatch

Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.

vars, rcid or logid is required however only one may be used.

Specific parameters:
Other general parameters are available.
filter

The full filter text to check for a match.

This parameter is required.
vars

JSON encoded array of variables to test against.

rcid

Recent change ID to check against.

Type: integer
logid

Edit filter log ID to check against.

Type: integer

action=abusefilterchecksyntax

Check syntax of an AbuseFilter filter.

Specific parameter:
Other general parameters are available.
filter

The full filter text to check syntax on.

This parameter is required.

action=abusefilterevalexpression

Evaluates an AbuseFilter expression.

Specific parameters:
Other general parameters are available.
expression

The expression to evaluate.

This parameter is required.
prettyprint

Whether the result should be pretty-printed.

Type: boolean (details)

action=abusefilterunblockautopromote

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Abuse Filter
  • License: GPL-2.0-or-later

Unblocks a user from receiving autopromotions due to an abusefilter consequence.

Specific parameters:
Other general parameters are available.
user

Username of the user you want to unblock.

This parameter is required.
Type: user, by username
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=abuselogprivatedetails

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Abuse Filter
  • License: GPL-2.0-or-later

View private details of an AbuseLog entry.

Specific parameters:
Other general parameters are available.
logid

The ID of the AbuseLog entry to be checked.

Type: integer
reason

A valid reason for performing the check.

Default: (empty)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Get private details for the AbuseLog entry with ID 1, using the reason "example".
api.php?action=abuselogprivatedetails&logid=1&reason=example&token=ABC123 [open in sandbox]

action=acquiretempusername

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.

If the user later performs an action that results in temp account creation, the stashed username will be used for their account. It may also be used in previews. However, the account is not created yet, and the name is not visible to other users.


action=antispoof

Check a username against AntiSpoof's normalisation checks.

Specific parameter:
Other general parameters are available.
username

The username to check against AntiSpoof.

This parameter is required.
Example:
Check username "Foo" against AntiSpoof
api.php?action=antispoof&username=Foo [open in sandbox]

action=block

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Block a user.

Specific parameters:
Other general parameters are available.
id

ID of the block to modify (obtained through list=blocks). Cannot be used together with user, reblock, or newblock.

Type: integer
user

User to block. Cannot be used together with id.

Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
expiry

Expiry time. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If set to infinite, indefinite, or never, the block will never expire.

Default: never
reason

Reason for block.

Default: (empty)
anononly

Block anonymous users only (i.e. disable anonymous edits for this IP address, including temporary account edits).

Type: boolean (details)
nocreate

Prevent account creation.

Type: boolean (details)
autoblock

Automatically block the last used IP address, and any subsequent IP addresses they try to login from.

Type: boolean (details)
noemail

Prevent user from sending email through the wiki. (Requires the blockemail right).

Type: boolean (details)
hidename

Hide the username from the block log. (Requires the hideuser right).

Type: boolean (details)
allowusertalk

Allow the user to edit their own talk page (depends on $wgBlockAllowsUTEdit).

Type: boolean (details)
reblock

If the user is already blocked by a single block, overwrite the existing block. If the user is blocked more than once, this will fail—use the id parameter instead to specify which block to overwrite. Cannot be used together with id or newblock.

Type: boolean (details)
newblock

Add another block even if the user is already blocked. Cannot be used together with id or reblock.

Type: boolean (details)
watchuser

Watch the user's or IP address's user and talk pages.

Type: boolean (details)
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
tags

Change tags to apply to the entry in the block log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
partial

Block user from specific pages or namespaces rather than the entire site.

Type: boolean (details)
pagerestrictions

List of titles to block the user from editing. Only applies when partial is set to true.

Type: page title
Separate values with | or alternative.
Maximum number of values is 50.
Only accepts pages that exist.
namespacerestrictions

List of namespace IDs to block the user from editing. Only applies when partial is set to true.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
actionrestrictions

List of actions to block the user from performing. Only applies when partial is set to true.

Values (separate with | or alternative): create, move, thanks, upload
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Block IP address 192.0.2.5 for three days with a reason.
api.php?action=block&user=192.0.2.5&expiry=3%20days&reason=First%20strike&token=123ABC [open in sandbox]
Block user Vandal indefinitely with a reason, and prevent new account creation and email sending.
api.php?action=block&user=Vandal&expiry=never&reason=Vandalism&nocreate=&autoblock=&noemail=&token=123ABC [open in sandbox]

action=bouncehandler

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: BounceHandler
  • License: GPL-2.0-or-later

Receive a bounce email and process it to handle the failing recipient.

Specific parameter:
Other general parameters are available.
email

The bounced email.

This parameter is required.
Example:
Receive a bounce email for processing with the content "This is a test email".
api.php?action=bouncehandler&email=This%20is%20a%20test%20email [open in sandbox]

action=categorytree

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CategoryTree
  • License: GPL-2.0-or-later

Internal module for the CategoryTree extension.

Specific parameters:
Other general parameters are available.
category

Title in the category namespace, prefix will be ignored if given.

This parameter is required.
options

Options for the CategoryTree constructor as a JSON object. The depth option defaults to 1.

action=centralauthtoken

Fetch a centralauthtoken for making an authenticated request to an attached wiki.

Returns a token that can be use to authenticate API requests on other wikis. For action API requests, put it in the centralauthtoken GET parameter. For REST API requests, add an Authorization: CentralAuthToken {token} header. In MediaWiki frontend logic, you can use the mediawiki.ForeignApi ResourceLoader module.

This wiki is configured to return a JSON Web Token from this API.


Example:
Fetch a centralauthtoken
api.php?action=centralauthtoken [open in sandbox]

action=centralnoticecdncacheupdatebanner

  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: CentralNotice
  • License: GPL-2.0-or-later

Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language

Specific parameters:
Other general parameters are available.
banner

Name of the banner whose content should be purged

This parameter is required.
language

Language of the banner content to purge

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=centralnoticechoicedata

Get data needed to choose a banner for a given project and language

Specific parameters:
Other general parameters are available.
project

The project to get banner choice data for.

This parameter is required.
language

The language to get banner choice data for.

This parameter is required.
Example:
Get the data for choosing a banner for English Wikipedia users.
api.php?action=centralnoticechoicedata&project=wikipedia&language=en [open in sandbox]

action=centralnoticequerycampaign

Get all configuration settings for a campaign.

Specific parameter:
Other general parameters are available.
campaign

Campaign name. Separate multiple values with a "|" (vertical bar).

This parameter is required.

action=changeauthenticationdata (changeauth)

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change authentication data for the current user.

Specific parameters:
Other general parameters are available.
changeauthrequest

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=change.

This parameter is required.
changeauthtoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=change (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=changecontentmodel

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the content model of a page

Specific parameters:
Other general parameters are available.
title

Title of the page to change the contentmodel of. Cannot be used together with pageid.

pageid

Page ID of the page to change the contentmodel of. Cannot be used together with title.

Type: integer
summary

Edit summary and log entry reason

tags

Change tags to apply to the log entry and edit.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
model

Content model of the new content.

This parameter is required.
One of the following values: GadgetDefinition, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, vue, wikitext
bot

Mark the content model change with a bot flag.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Change the main page to have the text content model
api.php?action=changecontentmodel&title=Main Page&model=text&token=123ABC [open in sandbox]

action=chartinfo

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Chart
  • License: GPL-3.0-or-later

Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.

Specific parameter:
Other general parameters are available.
global

Set to true to include all connected wikis instead of the local wiki only.

Type: boolean (details)

action=checktoken

Check the validity of a token from action=query&meta=tokens.

Specific parameters:
Other general parameters are available.
type

Type of token being tested.

This parameter is required.
One of the following values: createaccount, csrf, deleteglobalaccount, login, patrol, rollback, setglobalaccountstatus, userrights, watch
token

Token to test.

This parameter is required.
maxtokenage

Maximum allowed age of the token, in seconds.

Type: integer

action=cirrus-check-sanity

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Reports on the correctness of a range of page ids in the search index

Specific parameters:
Other general parameters are available.
cluster

The search cluster to check indices in

This parameter is required.
One of the following values: cloudelastic, codfw, eqiad
from

Page id to start checking at

This parameter is required.
Type: integer
The value must be no less than 0.
limit

The number of page ids to check

Type: integer or max
The value must be between 1 and 500.
Default: 100
sequenceid

The number of times this set of page ids has been checked

Type: integer
rerenderfrequency

Number of checks after which a page should be rerendered. Based off the provided sequenceid.

Type: integer
The value must be no less than 2.
Default: 16

action=cirrus-config-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch configuration.

Specific parameter:
Other general parameters are available.
prop

Type of configuration variables to dump

Values (separate with | or alternative): expectedindices, globals, namespacemap, profiles, replicagroup, usertesting
Default: globals|namespacemap|profiles|replicagroup
Example:
Get a dump of CirrusSearch configuration.
api.php?action=cirrus-config-dump [open in sandbox]

action=cirrus-profiles-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch profiles for this wiki.

Specific parameter:
Other general parameters are available.
verbose

Dump the profiles content

Type: boolean (details)
Example:
Get a dump of CirrusSearch profiles for this wiki.
api.php?action=cirrus-profiles-dump [open in sandbox]

action=cirrus-schema-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch schema (settings and mappings) for this wiki.

Specific parameters:
Other general parameters are available.
build

Whether to build the schema from code (true) or fetch from live cluster (false).

Type: boolean (details)
plugins

List of OpenSearch/Elasticsearch plugins available on the target cluster. Only used when build=true. If not provided, plugins will be detected from the connected cluster.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Examples:
Get a dump of CirrusSearch schema from the live cluster.
api.php?action=cirrus-schema-dump [open in sandbox]
Generate CirrusSearch schema from code configuration.
api.php?action=cirrus-schema-dump&build=true [open in sandbox]
Generate CirrusSearch schema with specific plugins enabled.
api.php?action=cirrus-schema-dump&build=true&plugins=analysis-icu|extra-analysis-textify [open in sandbox]

action=clearhasmsg

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Clears the hasmsg flag for the current user.

Example:
Clear the hasmsg flag for the current user.
api.php?action=clearhasmsg [open in sandbox]

action=clientlogin (login)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log in to the wiki using the interactive flow.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=login, and a login token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying loginreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with logincontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to loginreturnurl. Then post to this module with logincontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
loginrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=login or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
loginmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
loginmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
loginpreservestate

Preserve state from a previous failed login attempt, if possible.

Type: boolean (details)
loginreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or logincontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a logincontinue request to this API module.

logincontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or loginreturnurl is required.

Type: boolean (details)
loginreauthenticate

Instead of logging in, reauthenticate for getting temporary access to a security-sensitive operation. This must be done when already logged in, using the fields suplied by action=query&meta=authmanagerinfo when called with the amireauthenticate parameter. The value of the parameter should be the same as that of amireauthenticate.

logintoken

A "login" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=login (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
Examples:
Start the process of logging in to the wiki as user Example with password ExamplePassword.
api.php?action=clientlogin&username=Example&password=ExamplePassword&loginreturnurl=http://example.org/&logintoken=123ABC [open in sandbox]
Continue logging in after a UI response for two-factor auth, supplying an OATHToken of 987654.
api.php?action=clientlogin&logincontinue=1&OATHToken=987654&logintoken=123ABC [open in sandbox]

action=codemirror-validate

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CodeMirror
  • License: GPL-2.0-or-later

Check for validation errors in the given content

Specific parameters:
Other general parameters are available.
content

The text content to validate

This parameter is required.
contentmodel

Content model

This parameter is required.
One of the following values: Scribunto, javascript, sanitized-css
title

Title of page the content belongs to.

This parameter is required.
Type: page title
Accepts non-existent pages.

action=collection

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Collection
  • License: GPL-2.0-or-later

API module for performing various operations on a wiki user's collection.

Specific parameter:
Other general parameters are available.
submodule

Submodule for performing various operations on a wiki user's collection.

addarticle
API module for adding a page to the collection
addcategory
API module for adding pages from a given category to a user's collection.
addchapter
API module for adding a chapter to the collection
clearcollection
API module for clearing the collection and the suggestions
getbookcreatorboxcontent
API submodule for grabbing the box content of the user's book creator box special page.
getcollection
API module for listing the current pages in a collection
getpopupdata
API module to get data and HTML to construct a popup
postcollection
API module for posting pages to a user's collection
removearticle
API module for removing a page from the collection
removeitem
API module for removing an item from the collection index-wise via the Special:Book page.
renamechapter
API module for renaming a chapter in the user's collection
setsorting
API module for reordering items in a collection
settitles
API module for setting the collection's title, subtitle, and settings
sortitems
API module to sort pages in a collection alphabetically. Pages within chapters are grouped and sorted together.
suggestarticleaction
API module to interact with suggestions
suggestundoarticleaction
API module to undo actions done from suggestarticleaction
This parameter is required.
One of the following values: addarticle, addcategory, addchapter, clearcollection, getbookcreatorboxcontent, getcollection, getpopupdata, postcollection, removearticle, removeitem, renamechapter, setsorting, settitles, sortitems, suggestarticleaction, suggestundoarticleaction
Example:
Submodule for performing various operations on a wiki user's collection.
api.php?action=collection&submodule=getcollection [open in sandbox]

submodule=addarticle

API module for adding a page to the collection

Specific parameters:
Other general parameters are available.
namespace

Namespace of page to add

This parameter is required.
Type: integer
title

Title of page to add

This parameter is required.
oldid

Oldid of page to add

Type: integer
Default: 0

submodule=addcategory

API module for adding pages from a given category to a user's collection.

Specific parameter:
Other general parameters are available.
title

Category to add

Default: (empty)
Example:
Add pages from a given category to a user's collection.
api.php?action=collection&submodule=addcategory&title=Main_Page [open in sandbox]

submodule=addchapter

API module for adding a chapter to the collection

Specific parameter:
Other general parameters are available.
chaptername

Name of chapter to add

Default: (empty)

submodule=clearcollection

API module for clearing the collection and the suggestions


submodule=getbookcreatorboxcontent

API submodule for grabbing the box content of the user's book creator box special page.

Specific parameters:
Other general parameters are available.
hint

Hint shown in the creator box

Default: (empty)
oldid

Oldid of a collection

Type: integer
pagename

Title of a page

submodule=getcollection

API module for listing the current pages in a collection


Example:
List pages currently in the collection.
api.php?action=collection&submodule=getcollection [open in sandbox]

submodule=getpopupdata

API module to get data and HTML to construct a popup

Specific parameter:
Other general parameters are available.
title

Title of a page

This parameter is required.
Example:
Gets a popup to add a page to the collection or to remove it
api.php?action=collection&submodule=getpopupdata&title=foobar [open in sandbox]

submodule=postcollection

API module for posting pages to a user's collection

Specific parameter:
Other general parameters are available.
collection

Name of a collection

Default: (empty)

submodule=removearticle

API module for removing a page from the collection

Specific parameters:
Other general parameters are available.
namespace

Namespace of page to remove

This parameter is required.
Type: integer
title

Title of page to remove

This parameter is required.
oldid

Oldid of page to remove

Type: integer
Default: 0

submodule=removeitem

API module for removing an item from the collection index-wise via the Special:Book page.

Specific parameter:
Other general parameters are available.
index

Index of item to remove

Type: integer
Default: 0
Example:
Remove an item from the collection provided an index or index 0 by default.
api.php?action=collection&submodule=removeitem&index=2 [open in sandbox]

submodule=renamechapter

API module for renaming a chapter in the user's collection

Specific parameters:
Other general parameters are available.
index

Index of chapter to rename

This parameter is required.
Type: integer
chaptername

Name of chapter to rename

This parameter is required.

submodule=setsorting

API module for reordering items in a collection

Specific parameter:
Other general parameters are available.
items

Items should be listed using their old index and ordered by their new position

This parameter is required.
Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Examples:
In a collection of 3 items, swap the first and second item
api.php?action=collection&submodule=setsorting&items=1|0|2 [open in sandbox]
In a collection of 3 items, make the 3rd item first, and delete the 2nd item
api.php?action=collection-setsorting&items=2|0 [open in sandbox]

submodule=settitles

API module for setting the collection's title, subtitle, and settings

Specific parameters:
Other general parameters are available.
title

Title of the collection

This parameter is required.
subtitle

Subtitle of the collection

Default: (empty)
settings

Settings for the collection

Default: (empty)

submodule=sortitems

API module to sort pages in a collection alphabetically. Pages within chapters are grouped and sorted together.


Example:
Sort collection pages alphabetically
api.php?action=collection&submodule=sortitems [open in sandbox]

submodule=suggestarticleaction

API module to interact with suggestions

Specific parameters:
Other general parameters are available.
suggestaction

One of 'add', 'remove', or 'ban'. 'add' adds a page to the collection and suggestions and unbans it. 'remove' removes an added page and bans it. 'ban' bans a page from suggestions.

This parameter is required.
One of the following values: add, ban, remove
title

Title of a page

This parameter is required.

submodule=suggestundoarticleaction

API module to undo actions done from suggestarticleaction

Specific parameters:
Other general parameters are available.
lastaction

One of 'add', 'remove', or 'ban'.

This parameter is required.
One of the following values: add, ban, remove
title

Title of a page

This parameter is required.

action=communityconfigurationedit

  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: CommunityConfiguration
  • License: GPL-3.0-or-later

Change the content of a configuration provider in Community configuration

Specific parameters:
Other general parameters are available.
provider

Provider key

This parameter is required.
One of the following values: Babel, BlockedDomain, CampaignEvents, CommunityUpdates, ContentTranslation, GrowthHomepage, GrowthMentorList, GrowthSuggestedEdits, HelpPanel, Mentorship, ReportIncident, TemplateData-FeaturedTemplates
content

The current content of the provider will be replaced with this one. Use JSON to serialize the new content.

This parameter is required.
summary

Edit summary

Default: (empty)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=compare

Get the difference between two pages.

A revision number, a page title, a page ID, text, or a relative reference for both "from" and "to" must be passed.

Specific parameters:
Other general parameters are available.
fromtitle

First title to compare.

fromid

First page ID to compare.

Type: integer
fromrev

First revision to compare.

Type: integer
fromslots

Override content of the revision specified by fromtitle, fromid or fromrev.

This parameter specifies the slots that are to be modified. Use fromtext-{slot}, fromcontentmodel-{slot}, and fromcontentformat-{slot} to specify content for each slot.

Values (separate with | or alternative): main
fromtext-{slot}

Text of the specified slot. If omitted, the slot is removed from the revision.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
fromsection-{slot}

When fromtext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by fromtitle, fromid or fromrev as if for a section edit.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
fromcontentformat-{slot}

Content serialization format of fromtext-{slot}.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
fromcontentmodel-{slot}

Content model of fromtext-{slot}. If not supplied, it will be guessed based on the other parameters.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
frompst

Do a pre-save transform on fromtext-{slot}.

Type: boolean (details)
fromtext
Deprecated.

Specify fromslots=main and use fromtext-main instead.

fromcontentformat
Deprecated.

Specify fromslots=main and use fromcontentformat-main instead.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
fromcontentmodel
Deprecated.

Specify fromslots=main and use fromcontentmodel-main instead.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
fromsection
Deprecated.

Only use the specified section of the specified 'from' content.

totitle

Second title to compare.

toid

Second page ID to compare.

Type: integer
torev

Second revision to compare.

Type: integer
torelative

Use a revision relative to the revision determined from fromtitle, fromid or fromrev. All of the other 'to' options will be ignored.

One of the following values: cur, next, prev
toslots

Override content of the revision specified by totitle, toid or torev.

This parameter specifies the slots that are to be modified. Use totext-{slot}, tocontentmodel-{slot}, and tocontentformat-{slot} to specify content for each slot.

Values (separate with | or alternative): main
totext-{slot}

Text of the specified slot. If omitted, the slot is removed from the revision.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
tosection-{slot}

When totext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by totitle, toid or torev as if for a section edit.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
tocontentformat-{slot}

Content serialization format of totext-{slot}.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
tocontentmodel-{slot}

Content model of totext-{slot}. If not supplied, it will be guessed based on the other parameters.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
topst

Do a pre-save transform on totext.

Type: boolean (details)
totext
Deprecated.

Specify toslots=main and use totext-main instead.

tocontentformat
Deprecated.

Specify toslots=main and use tocontentformat-main instead.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
tocontentmodel
Deprecated.

Specify toslots=main and use tocontentmodel-main instead.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
tosection
Deprecated.

Only use the specified section of the specified 'to' content.

prop

Which pieces of information to get.

diff
The diff HTML.
diffsize
The size of the diff HTML, in bytes.
rel
The revision IDs of the revision previous to 'from' and after 'to', if any.
ids
The page and revision IDs of the 'from' and 'to' revisions.
title
The page titles of the 'from' and 'to' revisions.
user
The username and ID of the 'from' and 'to' revisions. If the user has been revision deleted, a fromuserhidden or touserhidden property will be returned.
comment
The comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
parsedcomment
The parsed comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
size
The size of the 'from' and 'to' revisions.
timestamp
The timestamp of the 'from' and 'to' revisions.
Values (separate with | or alternative): comment, diff, diffsize, ids, parsedcomment, rel, size, timestamp, title, user
Default: diff|ids|title
slots

Return individual diffs for these slots, rather than one combined diff for all slots.

Values (separate with | or alternative): main
To specify all values, use *.
difftype

Return the comparison formatted as inline HTML.

One of the following values: inline, table, unified
Default: table
Example:
Create a diff between revision 1 and 2.
api.php?action=compare&fromrev=1&torev=2 [open in sandbox]

action=createaccount (create)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Create a new user account.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=create, and a createaccount token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying createreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with createcontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to createreturnurl. Then post to this module with createcontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
createrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=create or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
createmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
createmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
createpreservestate

Preserve state from a previous failed login attempt, if possible.

If action=query&meta=authmanagerinfo returned true for hasprimarypreservedstate, requests marked as primary-required should be omitted. If it returned a non-empty value for preservedusername, that username must be used for the username parameter.

Type: boolean (details)
createreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or createcontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a createcontinue request to this API module.

createcontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or createreturnurl is required.

Type: boolean (details)
createtoken

A "createaccount" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=create (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=createlocalaccount

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CentralAuth
  • License: GPL-2.0-or-later

Forcibly create a local account. The central account must exist.

Specific parameters:
Other general parameters are available.
username

User to create the local account for.

This parameter is required.
reason

Reason for creating the local account.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=cspreport

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.

Specific parameters:
Other general parameters are available.
reportonly

Mark as being a report from a monitoring policy, not an enforced policy

Type: boolean (details)
source

What generated the CSP header that triggered this report

Default: internal

action=cxcheckunreviewed

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Check if any fast, unreviewed translation has been published recently for the current user.


action=cxdelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Delete a draft translation created using the Content Translation extension.

Specific parameters:
Other general parameters are available.
from

The source language code.

This parameter is required.
to

The target language code.

This parameter is required.
sourcetitle

The title of the source page.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Delete a draft associated with given language pair and title.
api.php?action=cxdelete&from=en&to=es&sourcetitle=Food [open in sandbox]

action=cxfavoritesuggestions

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Add or remove a favorite suggestion to the current user's list.

Specific parameters:
Other general parameters are available.
listaction

Action to be performed on the given favorite suggestion title. Available options: 'add' and 'remove'

This parameter is required.
One of the following values: add, remove
title

The title of the favorite suggestion on which the action should be performed

This parameter is required.
from

The source language of the favorite suggestion on which the action should be performed

This parameter is required.
to

The target language of the favorite suggestion on which the action should be performed

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Add a suggestion to the user's list of favorite suggestions
api.php?action=cxfavoritesuggestions&listaction=add&title=Title&from=en&to=es [open in sandbox]
Remove a suggestion from the user's list of favorite suggestions
api.php?action=cxfavoritesuggestions&listaction=remove&title=Title&from=en&to=es [open in sandbox]

action=cxpublish

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Save a page created using the Content Translation extension.

Specific parameters:
Other general parameters are available.
title

The title of the page to perform actions on.

This parameter is required.
html

The content to save.

This parameter is required.
from

The source language code.

This parameter is required.
to

The target language code.

This parameter is required.
sourcetitle

The title of the source page.

This parameter is required.
categories

The categories to put the published page in.

publishtags

The edit tags to add to the published page.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wpCaptchaId

Captcha ID (when saving with a captcha response).

wpCaptchaWord

Answer to the captcha (when saving with a captcha response).

cxversion

Version of the editor used to publish the translation.

This parameter is required.
Type: integer
The value must be between 1 and 2.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=cxpublishsection

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Save a section created using the Content Translation extension's section translation feature.

Specific parameters:
Other general parameters are available.
title

The title of the page to perform actions on.

This parameter is required.
html

The content to save.

This parameter is required.
sourcelanguage

The source language code.

This parameter is required.
targetlanguage

The target language code.

This parameter is required.
sourcetitle

The title of the source page.

This parameter is required.
sourcerevid

The source page revision id.

This parameter is required.
sourcesectiontitle

The title of the source section.

This parameter is required.
targetsectiontitle

The title of the target section.

This parameter is required.
sectiontranslationid

The section translation id associated with the draft section translation.

This parameter is required.
Type: integer
publishtarget

The publishing target of the section translation. Possible values: 'SANDBOX', 'NEW_SECTION', 'EXPAND' and 'REPLACE'.

One of the following values: EXPAND, NEW_SECTION, REPLACE, SANDBOX
existingsectiontitle

The title of the existing section that is going to be expanded.

captchaid

Captcha ID (when saving with a captcha response).

captchaword

Answer to the captcha (when saving with a captcha response).

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=cxsave

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

This module allows to save draft translations by section to save bandwidth and to collect parallel corpora.

Specific parameters:
Other general parameters are available.
from

The source language code.

This parameter is required.
to

The target language code.

This parameter is required.
sourcetitle

The title of the source page.

This parameter is required.
title

The title of the page to perform actions on.

This parameter is required.
content

JSON-encoded section data. Each section is an object and has the following keys: content, sectionId, sequenceId, sequenceId, origin

This parameter is required.
sourcerevision

The revision of the source page.

This parameter is required.
Type: integer
progress

Information about translation completion (progress). JSON with the keys any, human, mt and mtSectionsCount. The keys' values are percentages.

This parameter is required.
cxversion

Version of the editor used to create the draft translation.

Type: integer
The value must be between 1 and 2.
sourcecategories

JSON encoded array of source categories to be saved with draft translation.

Cannot be longer than 65,535 bytes.
targetcategories

JSON encoded array of target categories to be saved with draft translation.

Cannot be longer than 65,535 bytes.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=cxsplit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Create and save a section translation to database, for every translated section of the given article translation

Specific parameters:
Other general parameters are available.
translationid

The id of the translation, for which the section translations will be created.

This parameter is required.
Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=cxtoken

  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get JWT tokens to authenticate with cxserver.

Specific parameter:
Other general parameters are available.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Fetch the authentication token for cxserver
api.php?action=cxtoken&token=123ABC [open in sandbox]

action=delete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Delete a page.

Specific parameters:
Other general parameters are available.
title

Title of the page to delete. Cannot be used together with pageid.

pageid

Page ID of the page to delete. Cannot be used together with title.

Type: integer
reason

Reason for the deletion. If not set, an automatically generated reason will be used.

tags

Change tags to apply to the entry in the deletion log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
deletetalk

Delete the talk page, if it exists.

Type: boolean (details)
watch
Deprecated.

Add the page to the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
unwatch
Deprecated.

Remove the page from the current user's watchlist.

Type: boolean (details)
oldimage

The name of the old image to delete as provided by action=query&prop=imageinfo&iiprop=archivename.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=deleteglobalaccount

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CentralAuth
  • License: GPL-2.0-or-later

Delete a global user.

Specific parameters:
Other general parameters are available.
user

User to delete.

This parameter is required.
reason

Reason for deleting the user.

token

A "deleteglobalaccount" token retrieved from action=query&meta=tokens

This parameter is required.

action=discussiontoolscompare

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Get information about comment changes between two page revisions.

Specific parameters:
Other general parameters are available.
fromtitle

First title to compare.

fromrev

First revision to compare.

Type: integer
totitle

Second title to compare.

torev

Second revision to compare.

Type: integer

action=discussiontoolsedit

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Post a message on a discussion page.

Specific parameters:
Other general parameters are available.
paction

Action to perform.

addcomment
Add a new comment as a reply to an existing comment.
addtopic
Add a new discussion section and the first comment in it.
This parameter is required.
One of the following values: addcomment, addtopic
autosubscribe

Automatically subscribe the user to the talk page thread?

One of the following values: default, no, yes
Default: default
page

The page to perform actions on.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
formtoken

An optional unique ID generated in the client to prevent double-posting.

Cannot be longer than 16 characters.
commentname

Name of the comment to reply to. Only used when paction is addcomment.

commentid

ID of the comment to reply to. Only used when paction is addcomment. Overrides commentname.

wikitext

Content to post, as wikitext. Cannot be used together with html.

html

Content to post, as HTML. Cannot be used together with wikitext.

summary

Edit summary.

sectiontitle

The title for a new section when using $1section=new. Only used when paction is addtopic.

allownosectiontitle

Allow posting a new section without a title.

Type: boolean (details)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

captchaid

Captcha ID (when saving with a captcha response).

captchaword

Answer to the captcha (when saving with a captcha response).

nocontent

Omit the HTML content of the new revision in the response.

tags

Change tags to apply to the edit.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
mobileformat

Return parse output in a format suitable for mobile devices.

Type: boolean (details)

action=discussiontoolsfindcomment

  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Find a comment by its ID or name.

Specific parameters:
Other general parameters are available.
idorname

Comment ID or name

heading

Heading hash fragment

page

Page that the heading hash fragment once existed on

action=discussiontoolsgetsubscriptions

  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Get the subscription statuses of given topics.

Specific parameter:
Other general parameters are available.
commentname

Names of the topics to check

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=discussiontoolspageinfo

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Returns metadata required to initialize the discussion tools.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

oldid

The revision number to use (defaults to latest revision).

Type: integer
prop

Which properties to get:

transcludedfrom
Which other pages comments have been transcluded from
threaditemshtml
Representation of the comment threads parsed from the page
Values (separate with | or alternative): threaditemshtml, transcludedfrom
Default: transcludedfrom
threaditemsflags

Flags to alter the output when using prop=threaditemshtml.

noreplies
Don't include the full reply tree, just provide the top-level headings (when using prop=threaditemshtml).
activity
Include extra activity data about the oldest and latest replies (when using prop=threaditemshtml).
excludesignatures
Exclude user signatures from the comments (when using prop=threaditemshtml).
Values (separate with | or alternative): activity, excludesignatures, noreplies
excludesignatures
Deprecated.

Exclude user signatures from the comments (when using prop=threaditemshtml).

action=discussiontoolspreview

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Preview a message on a discussion page.

Specific parameters:
Other general parameters are available.
type

Type of message to preview

reply
Add a new comment as a reply to an existing comment.
topic
Add a new discussion section and the first comment in it.
This parameter is required.
One of the following values: reply, topic
page

The page to perform actions on.

This parameter is required.
wikitext

Content to preview, as wikitext.

This parameter is required.
sectiontitle

The title for a new section when using section=new.

useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
mobileformat

Return parse output in a format suitable for mobile devices.

Type: boolean (details)

action=discussiontoolssubscribe

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Subscribe (or unsubscribe) to receive notifications about a topic.

Specific parameters:
Other general parameters are available.
page

A page on which the topic appears

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
commentname

Name of the topic to subscribe to (or unsubscribe from)

This parameter is required.
subscribe

True to subscribe, false to unsubscribe

This parameter is required.
Type: boolean (details)

action=discussiontoolsthank

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Send a public thank-you notification for a comment.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

This parameter is required.
commentid

ID of the comment to thank.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echocreateevent

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Manually trigger a notification to a user

Specific parameters:
Other general parameters are available.
user

User to send the notification to

Type: user, by any of username and user ID (e.g. "#12345")
header

Header content of the notification

This parameter is required.
Cannot be longer than 160 bytes.
content

Body content of the notification

This parameter is required.
Cannot be longer than 5,000 bytes.
page

Page to link to in the notification

Type: page title
Accepts non-existent pages.
section

Section where notification would be delivered

This parameter is required.
One of the following values: alert, notice
Default: notice
email

Whether to send an email as well

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echomarkread

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Mark notifications as read for the current user.

Specific parameters:
Other general parameters are available.
wikis

List of wikis to mark notification as read (defaults to only current wiki).

Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: enwiki
list

A list of notification IDs to mark as read.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unreadlist

A list of notification IDs to mark as unread.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
all

If set, marks all of a user's notifications as read.

Type: boolean (details)
sections

A list of sections to mark as read.

Values (separate with | or alternative): alert, message
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echomarkseen

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Mark notifications as seen for the current user.

Specific parameters:
Other general parameters are available.
type

Type of notifications to mark as seen: 'alert', 'message' or 'all'.

This parameter is required.
One of the following values: alert, all, message
timestampFormat

Timestamp format to use for output, 'ISO_8601' or 'MW'. 'MW' is deprecated here, so all clients should switch to 'ISO_8601'. This parameter will be removed, and 'ISO_8601' will become the only output format.

One of the following values: ISO_8601, MW
Default: MW
Example:
Mark notifications of all types as seen
api.php?action=echomarkseen&type=all [open in sandbox]

action=echomute

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Mute or unmute notifications from certain users or pages.

Specific parameters:
Other general parameters are available.
type

Which mute list to add to or remove from

This parameter is required.
One of the following values: page-linked-title, user
mute

Pages or users to add to the mute list

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unmute

Pages or users to remove from the mute list

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echopushsubscriptions

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Manage push subscriptions for the current user.

Specific parameters:
Other general parameters are available.
command

Action to perform.

create
Internal. Register push subscriptions for the current user.
delete
Internal. Unregister push subscriptions for the current user or another specified user.
This parameter is required.
One of the following values: create, delete
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

command=create

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Register push subscriptions for the current user.

Specific parameters:
Other general parameters are available.
provider

The push service provider for which to register a token.

This parameter is required.
One of the following values: apns, fcm
providertoken

The token to register.

This parameter is required.
topic

The APNS topic (app bundle ID) to send the notification to.

command=delete

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Unregister push subscriptions for the current user or another specified user.

Specific parameter:
Other general parameters are available.
providertoken

The token associated with the push subscription to unregister.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Example:
Unregister a push subscription for the current user.
api.php?action=echopushsubscriptions&command=delete&providertoken=ABC123 [open in sandbox]

action=edit

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Create and edit pages.

Specific parameters:
Other general parameters are available.
title

Title of the page to edit. Cannot be used together with pageid.

pageid

Page ID of the page to edit. Cannot be used together with title.

Type: integer
section

Section identifier. 0 for the top section, new for a new section. Often a positive integer, but can also be non-numeric.

sectiontitle

The title for a new section when using section=new.

text

Page content.

summary

Edit summary.

When this parameter is not provided or empty, an edit summary may be generated automatically.

When using section=new and sectiontitle is not provided, the value of this parameter is used for the section title instead, and an edit summary is generated automatically.

tags

Change tags to apply to the revision.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
minor

Mark this edit as a minor edit.

Type: boolean (details)
notminor

Do not mark this edit as a minor edit even if the "Mark all edits minor by default" user preference is set.

Type: boolean (details)
bot

Mark this edit as a bot edit.

Type: boolean (details)
baserevid

ID of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions. Self-conflicts cause the edit to fail unless basetimestamp is set.

Type: integer
basetimestamp

Timestamp of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions&rvprop=timestamp. Self-conflicts are ignored.

Type: timestamp (allowed formats)
starttimestamp

Timestamp when the editing process began, used to detect edit conflicts. An appropriate value may be obtained using curtimestamp when beginning the edit process (e.g. when loading the page content to edit).

Type: timestamp (allowed formats)
recreate

Override any errors about the page having been deleted in the meantime.

Type: boolean (details)
createonly

Don't edit the page if it already exists.

Type: boolean (details)
nocreate

Throw an error if the page doesn't exist.

Type: boolean (details)
watch
Deprecated.

Add the page to the current user's watchlist.

Type: boolean (details)
unwatch
Deprecated.

Remove the page from the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
md5

The MD5 hash of the text parameter, or the prependtext and appendtext parameters concatenated. If set, the edit won't be done unless the hash is correct.

prependtext

Add this text to the beginning of the page or section. Overrides text.

appendtext

Add this text to the end of the page or section. Overrides text.

Use section=new to append a new section, rather than this parameter.

undo

Undo this revision. Overrides text, prependtext and appendtext.

Type: integer
The value must be no less than 0.
undoafter

Undo all revisions from undo to this one. If not set, just undo one revision.

Type: integer
The value must be no less than 0.
redirect

Automatically resolve redirects.

Type: boolean (details)
contentformat

Content serialization format used for the input text.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
contentmodel

Content model of the new content.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
token

A "csrf" token retrieved from action=query&meta=tokens

The token should always be sent as the last parameter, or at least after the text parameter.

This parameter is required.
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
captchaword

Answer to the CAPTCHA

captchaid

CAPTCHA ID from previous request

editorinterface

Name of the editor interface used (such as MobileFrontend-SourceEditor)

discussiontoolsautosubscribe

Automatically subscribe the user to any new talk page threads created by the edit. Use 'yes' or 'no' to override a user's preference (the default).

One of the following values: no, preferences, yes
Default: preferences

action=editcheckreferenceurl

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: VisualEditor
  • License: MIT

Check the status of a URL for use as a reference.

Specific parameter:
Other general parameters are available.
url

URL to check.

This parameter is required.

action=editmassmessagelist

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MassMessage
  • License: GPL-2.0-or-later

Edit a mass message delivery list.

Specific parameters:
Other general parameters are available.
spamlist

Title of the delivery list to update.

This parameter is required.
description

New description for the delivery list.

add

Titles to add to the list.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
remove

Titles to remove from the list.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
minor

Whether the edit should be marked as minor in the history of the list.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=emailuser

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Email a user.

Specific parameters:
Other general parameters are available.
target

User to send the email to.

This parameter is required.
subject

Subject header.

This parameter is required.
text

Email body.

This parameter is required.
ccme

Send a copy of this mail to me.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Send an email to the user WikiSysop with the text Content.
api.php?action=emailuser&target=WikiSysop&text=Content&token=123ABC [open in sandbox]

action=expandtemplates

Expands all templates within wikitext.

Specific parameters:
Other general parameters are available.
title

Title of the page.

text

Wikitext to convert.

This parameter is required.
revid

Revision ID, for {{REVISIONID}} and similar variables.

Type: integer
prop

Which pieces of information to get.

Note that if no values are selected, the result will contain the wikitext, but the output will be in a deprecated format.

wikitext
The expanded wikitext.
categories
Any categories present in the input that are not represented in the wikitext output.
properties
Page properties defined by expanded magic words in the wikitext.
volatile
Whether the output is volatile and should not be reused elsewhere within the page.
ttl
The maximum time after which caches of the result should be invalidated.
modules
Any ResourceLoader modules that parser functions have requested be added to the output. Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
jsconfigvars
Gives the JavaScript configuration variables specific to the page.
encodedjsconfigvars
Gives the JavaScript configuration variables specific to the page as a JSON string.
parsetree
The XML parse tree of the input.
Values (separate with | or alternative): categories, encodedjsconfigvars, jsconfigvars, modules, parsetree, properties, ttl, volatile, wikitext
includecomments

Whether to include HTML comments in the output.

Type: boolean (details)
showstrategykeys

Whether to include internal merge strategy information in jsconfigvars.

Type: boolean (details)
generatexml
Deprecated.

Generate XML parse tree (replaced by prop=parsetree).

Type: boolean (details)
templatesandboxprefix

Template sandbox prefix, as with Special:TemplateSandbox.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
templatesandboxtitle

Parse the page using templatesandboxtext in place of the contents of the page named here.

templatesandboxtext

Parse the page using this page content in place of the page named by templatesandboxtitle.

templatesandboxcontentmodel

Content model of templatesandboxtext.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
templatesandboxcontentformat

Content format of templatesandboxtext.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
Example:
Expand the wikitext {{Project:Sandbox}}.
api.php?action=expandtemplates&text={{Project:Sandbox}} [open in sandbox]

action=fancycaptchareload

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: ConfirmEdit
  • License: GPL-2.0-or-later

Get a new FancyCaptcha.


action=featuredfeed

  • This module requires read rights.
  • Source: FeaturedFeeds
  • License: WTFPL

Returns a featured content feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
feed

Feed name.

This parameter is required.
One of the following values: featured, onthisday, potd
language

Feed language code. Ignored by some feeds.

action=feedcontributions

Returns a user's contributions feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
user

What users to get the contributions for.

This parameter is required.
Type: user, by any of username, IP, Temporary user, IP range, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
namespace

Which namespace to filter the contributions by.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
year

From year (and earlier).

Type: integer
month

From month (and earlier).

Type: integer
tagfilter

Filter contributions that have these tags.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Citing predatory open access journal, Contest or editathon, Deputy, End of page text, External Link added to disambiguation page, Extraneous formatting, HotCat, JWB, Newcomer task, New user adding protection template, OAuth CID: 21, OAuth CID: 60, OAuth CID: 64, OAuth CID: 67, OAuth CID: 76, OAuth CID: 85, OAuth CID: 99, OAuth CID: 115, OAuth CID: 142, OAuth CID: 144, OAuth CID: 150, OAuth CID: 151, OAuth CID: 154, OAuth CID: 159, OAuth CID: 194, OAuth CID: 206, OAuth CID: 211, OAuth CID: 212, OAuth CID: 218, OAuth CID: 236, OAuth CID: 239, OAuth CID: 251, OAuth CID: 252, OAuth CID: 259, OAuth CID: 261, OAuth CID: 263, OAuth CID: 274, OAuth CID: 278, OAuth CID: 285, OAuth CID: 297, OAuth CID: 306, OAuth CID: 314, OAuth CID: 320, OAuth CID: 376, OAuth CID: 410, OAuth CID: 429, OAuth CID: 473, OAuth CID: 540, OAuth CID: 542, OAuth CID: 543, OAuth CID: 563, OAuth CID: 593, OAuth CID: 612, OAuth CID: 628, OAuth CID: 651, OAuth CID: 670, OAuth CID: 678, OAuth CID: 679, OAuth CID: 817, OAuth CID: 860, OAuth CID: 861, OAuth CID: 874, OAuth CID: 951, OAuth CID: 1003, OAuth CID: 1013, OAuth CID: 1015, OAuth CID: 1024, OAuth CID: 1188, OAuth CID: 1224, OAuth CID: 1232, OAuth CID: 1261, OAuth CID: 1277, OAuth CID: 1352, OAuth CID: 1359, OAuth CID: 1365, OAuth CID: 1389, OAuth CID: 1413, OAuth CID: 1436, OAuth CID: 1452, OAuth CID: 1503, OAuth CID: 1566, OAuth CID: 1703, OAuth CID: 1745, OAuth CID: 1779, OAuth CID: 1784, OAuth CID: 1804, OAuth CID: 1805, OAuth CID: 1809, OAuth CID: 1841, OAuth CID: 1887, OAuth CID: 1904, OAuth CID: 2008, OAuth CID: 2179, OAuth CID: 2395, OAuth CID: 2786, OAuth CID: 2922, OAuth CID: 3113, OAuth CID: 3201, OAuth CID: 3251, OAuth CID: 3711, OAuth CID: 4476, OAuth CID: 4664, OAuth CID: 4978, OAuth CID: 5481, OAuth CID: 5765, OAuth CID: 6365, OAuth CID: 6544, OAuth CID: 6640, OAuth CID: 6969, OAuth CID: 8393, OAuth CID: 9394, OAuth CID: 9792, OAuth CID: 10649, OAuth CID: 13185, OAuth CID: 13506, OAuth CID: 13933, OAuth CID: 14358, OAuth CID: 14740, OAuth CID: 14811, OAuth CID: 16301, OAuth CID: 16534, OAuth CID: 16734, OAuth CID: 16794, OAuth CID: 17034, OAuth CID: 17091, OAuth CID: 17154, OAuth CID: 17361, OAuth CID: 17546, OAuth CID: 17716, OAuth CID: 17725, OAuth CID: 17726, OAuth CID: 17755, OAuth CID: 17941, Possible disruption, Possible self promotion in user or draftspace, Possible self promotion in userspace, ProveIt edit, Rapid reverts, RedWarn, RfC, Section blanking, Ultraviolet, WPCleaner, WikiLeaks, WikiLoop Battlefield, WikiShield script, XFDC, abusefilter-condition-limit, advanced mobile edit, android app edit, app-ai-assist, app-description-add, app-description-change, app-description-translate, app-full-source, app-image-add-infobox, app-image-add-top, app-image-caption-add, app-image-caption-translate, app-image-tag-add, app-rollback, app-section-source, app-select-source, app-suggestededit, app-talk-reply, app-talk-source, app-talk-topic, app-undo, autobiography, bad external, blanking, bot trial, campaign-external-machine-translation, canned edit summary, categories removed, centralnotice, centralnotice translation, changing height or weight, changing time or duration, coi-spam, community configuration, congressedits, contentious topics alert, contenttranslation, contenttranslation-high-unmodified-mt-text, contenttranslation-needcheck, contenttranslation-v2, convenient-discussions, de-userfying, deprecated source, disambiguation template removed, disambiguator-link-added, discussiontools, discussiontools-added-comment, discussiontools-edit, discussiontools-newtopic, discussiontools-reply, discussiontools-source, discussiontools-source-enhanced, discussiontools-visual, draft-userpage-link, editProtectedHelper, editcheck-newcontent, editcheck-newreference, editcheck-paste-shown, editcheck-reference-decline-common-knowledge, editcheck-reference-decline-irrelevant, editcheck-reference-decline-other, editcheck-reference-decline-uncertain, editcheck-references, editcheck-references-activated, editcheck-references-shown, editcheck-tone, editcheck-tone-shown, editsuggestion-seen, editsuggestion-used, excessive whitespace, extraneous markup, fa-ga-change, fileimporter-remote, fixed lint errors, harv-error, help module question, help panel question, huggle, image template removal, invalid-timedtext-edit, ios app edit, large non-free file, large plot addition, large unwikified new article, massmessage-delivery, massmove, mentor list change, mentorship module question, mentorship panel question, missing file added, mobile app edit, mobile edit, mobile web edit, moveToDraft, mw-blank, mw-changed-redirect-target, mw-contentmodelchange, mw-edited-other-users-css, mw-edited-other-users-js, mw-ipblock-appeal, mw-manual-revert, mw-new-redirect, mw-recreated, mw-removed-redirect, mw-replace, mw-reverted, mw-rollback, mw-server-side-upload, mw-undo, newcomer task, newcomer task add link, newcomer task copyedit, newcomer task expand, newcomer task image suggestion, newcomer task links, newcomer task references, newcomer task revise tone, newcomer task section image suggestion, newcomer task update, new user modifying archives, new user moving page out of userspace, non-English content, nowiki added, nuke, ooze, pageswap, pagetriage, parliamentedit, parsermigration-visual-bug, possible AI-generated citations, possible BLPCRIME issue, possible MOS:ETHNICITY violation, possible birth or death date change, possible cut and paste move, possible formatting issues, possible libel or vandalism, possible link spam, possible prose issues, possible unexplained content removal, possible unreferenced addition to BLP, possible vandalism, possibly inaccurate edit summary, pronoun-change, rapid date format changes, reference list removal, references removed, removal of COI template, removal of Category:Living People, removal of copyvio templates, removal of speedy deletion templates, removing declined unblock request, reverting anti-vandal bot, sectiontranslation, self-published-blog, self-published source, self-renaming and bad user talk moves, shortdesc helper, shouting, talk banner shell conversion, talk page blanking, twinkle, unsourced AFC submission, unusual redirect, userspace spam, very short new article, visualeditor, visualeditor-needcheck, visualeditor-switched, visualeditor-wikitext, wikieditor, wikilinks removed, wikilove
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: (empty)
deletedonly

Show only deleted contributions.

Type: boolean (details)
toponly

Only show edits that are the latest revisions.

Type: boolean (details)
newonly

Only show edits that are page creations.

Type: boolean (details)
hideminor

Hide minor edits.

Type: boolean (details)
showsizediff

Disabled due to miser mode.

Type: boolean (details)
Example:
Return contributions for user Example.
api.php?action=feedcontributions&user=Example [open in sandbox]

action=feedrecentchanges

Returns a recent changes feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
namespace

Namespace to limit the results to.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
invert

All namespaces but the selected one.

Type: boolean (details)
associated

Include associated (talk or main) namespace.

Type: boolean (details)
days

Days to limit the results to.

Type: integer
The value must be no less than 1.
Default: 7
limit

Maximum number of results to return.

Type: integer
The value must be between 1 and 50.
Default: 50
from

Show changes since then.

Type: timestamp (allowed formats)
hideminor

Hide minor changes.

Type: boolean (details)
hidebots

Hide changes made by bots.

Type: boolean (details)
hideanons

Hide changes made by anonymous users and temporary accounts.

Type: boolean (details)
hideliu

Hide changes made by registered users.

Type: boolean (details)
hidepatrolled

Hide patrolled changes.

Type: boolean (details)
hidemyself

Hide changes made by the current user.

Type: boolean (details)
hidecategorization

Hide category membership changes.

Type: boolean (details)
tagfilter

Filter by tag.

inverttags

All edits except ones tagged with the selected ones.

Type: boolean (details)
target

Show only changes on pages linked from this page.

showlinkedto

Show changes on pages linked to the selected page instead.

Type: boolean (details)

action=feedwatchlist

Returns a watchlist feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
hours

List pages modified within this many hours from now.

Type: integer
The value must be between 1 and 72.
Default: 24
linktosections

Link directly to changed sections if possible.

Type: boolean (details)
allrev

Include multiple revisions of the same page within given timeframe.

Type: boolean (details)
wlowner

Used along with token to access a different user's watchlist.

Type: user, by username
wltoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wlshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set show=minor|!anon.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
wltype

Which types of changes to show:

edit
Regular page edits.
new
Page creations.
log
Log entries.
external
External changes.
categorize
Category membership changes.
Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
wlexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
Examples:
Show the watchlist feed.
api.php?action=feedwatchlist [open in sandbox]
Show all changes to watched pages in the past 6 hours.
api.php?action=feedwatchlist&allrev=&hours=6 [open in sandbox]

action=filerevert

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Revert a file to an old version.

Specific parameters:
Other general parameters are available.
filename

Target filename, without the File: prefix.

This parameter is required.
comment

Upload comment.

Default: (empty)
archivename

Archive name of the revision to revert to.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=flagconfig

  • This module requires read rights.
  • Source: FlaggedRevs (Pending Changes)
  • License: GPL-2.0-or-later

Get basic information about review flag configuration for this site.

The following parameters are returned for each tag:

name
The key name of this tag.
levels
Number of levels the tag has (above "not tagged").

Flagged revisions have an assigned level for each tag. The highest tier that all the tags meet is the review tier of the entire revision.


Example:
Fetch flag configuration
api.php?action=flagconfig [open in sandbox]

action=globalblock

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GlobalBlocking
  • License: GPL-2.0-or-later

Globally block or unblock a user.

Specific parameters:
Other general parameters are available.
id

ID of the global block to modify or unblock (obtained through list=globalblocks). Cannot be used together with target.

Type: integer
target

The target IP address or username. Cannot be used together with id.

Type: user, by any of username, IP, Temporary user and IP range
expiry

If specified, will block or reblock the user. Determines how long the block will last for, e.g. "5 months" or "2 weeks". If set to "infinite" or "indefinite" the block will never expire.

Type: expiry (details)
unblock

If specified, will unblock the user.

Type: boolean (details)
reason

The reason for blocking/unblocking.

This parameter is required.
anononly

Specify this if the block should only affect logged-out users globally.

Type: boolean (details)
allow-account-creation

Specify this if the global block should not prevent account creation.

Type: boolean (details)
enable-autoblock

Specify this if the global block should trigger global autoblocks.

Type: boolean (details)
block-email

Specify this if the global block should prevent the user from sending email.

Type: boolean (details)
modify

Specify this if the existing block on the target should be modified

Type: boolean (details)
alsolocal

Block the user locally as well. Cannot be used together with id.

Type: boolean (details)
localblockstalk

Revoke talk page access locally. Cannot be used together with id.

Type: boolean (details)
localblocksemail

Revoke email access locally. Cannot be used together with id.

Type: boolean (details)
localanononly

Specify this if the block should only affect logged-out users locally. Cannot be used together with id.

Type: boolean (details)
local-allow-account-creation

Specify this if the local block should not prevent account creation. Cannot be used together with id.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=globalpreferenceoverrides

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GlobalPreferences
  • License: GPL-2.0-or-later

Change local overrides for global preferences for the current user.

Global values for affected preferences will be ignored.

Specific parameters:
Other general parameters are available.
reset

Reset local overrides. Removes all, or, depending on the value of the resetkinds parameter, some types of local overrides and makes them global again.

Type: boolean (details)
resetkinds

List of types of overrides to reset when the reset option is set.

Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
Default: all
change

List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., preferencename|otherpreference|..., the override will be removed. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
optionname

The name of the override that should be set to the value given by optionvalue.

optionvalue

The value for the override specified by optionname.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=globalpreferences

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GlobalPreferences
  • License: GPL-2.0-or-later

Change global preferences of the current user.

Only preferences registered for the current wiki can be changed locally.

Specific parameters:
Other general parameters are available.
reset

Reset global preferences. Removes all, or, depending on the value of the resetkinds parameter, some types of global preferences and make them not global anymore.

Type: boolean (details)
resetkinds

List of types of preferences to reset when the reset option is set.

Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
Default: all
change

List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., preferencename|otherpreference|..., the preference will be made non-global. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
optionname

The name of the preference that should be set to the value given by optionvalue.

optionvalue

The value for the preference specified by optionname.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=globaluserrights

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CentralAuth
  • License: GPL-2.0-or-later

Add/remove a user to/from global groups.

Specific parameters:
Other general parameters are available.
user

Global username.

Type: user, by any of username and user ID (e.g. "#12345")
userid
Deprecated.

Global user ID.

Type: integer
add

Add the user to these global groups.

Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
expiry

Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: infinite
remove

Remove the user from these global groups.

Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
reason

Reason for the change.

Default: (empty)
token

A "userrights" token retrieved from action=query&meta=tokens

For compatibility, the token used in the web UI is also accepted.

This parameter is required.
tags

This parameter is currently unused.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
Examples:
Add user FooBot to global group "bot", and remove from global groups "sysop" and "bureaucrat"
api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
Add the global user with ID 123 to global group "bot", and remove from global groups "sysop" and "bureaucrat"
api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]

action=growthinvalidateimagerecommendation

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Invalidate an image recommendation.

Calling this API will:

  • Generate and send an event to EventGate to the image-suggestion-feedback stream. This allows improvements in the image suggestion pipeline, as the code in the pipeline can account for user feedback when generating recommendations.

Further reading: mediawiki.org

Specific parameters:
Other general parameters are available.
tasktype

Task type (top-level or section-level)

One of the following values: image-recommendation, section-image-recommendation
Default: image-recommendation
title

Title of the article the image recommendation task is for

This parameter is required.
Type: page title
Accepts non-existent pages.
filename

The unprefixed filename for the image recommendation, e.g. Foo.jpg

This parameter is required.
sectiontitle

The title of the section the image recommendation is for, e.g. History

sectionnumber

The 1-based index of the section the image recommendation is for, e.g. 3

Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthinvalidatepersonalizedpraisesuggestion

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard

Specific parameters:
Other general parameters are available.
mentee

Mentee to invalidate

This parameter is required.
Type: user, by any of username and user ID (e.g. "#12345")
reason

Reason to invalidate the suggestion

One of the following values: praised, skipped
skipreason

Skip reason to invalidate the suggestion

One of the following values: already-praised, not-now, not-praiseworthy, other
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthinvalidaterevisetonerecommendation

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Drop a 'Revise Tone' recommendation for a given page.

Specific parameters:
Other general parameters are available.
title

Title of the page for which to drop the recommendation, without namespace.

This parameter is required.
Type: page title
Only accepts pages that exist.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthmanagementorlist

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).

Specific parameters:
Other general parameters are available.
geaction

Action

This parameter is required.
One of the following values: add, change, remove
message

Introduction message (use an empty string for the default mentor message)

weight

Weight

One of the following values: 0, 1, 2, 4
isaway

Is the mentor currently away? Has to be set (defaults to false).

Type: boolean (details)
awaytimestamp

Until when is the mentor away? Maximum is 1 year from today. Ignored unless isaway is true.

Type: timestamp (allowed formats)
summary

Reason for the change

Default: (empty)
username

Username of the mentor affected by the change. If not provided, currently logged in user will be used. Can be only used by privileged users.

Type: user, by username
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthmentordashboardupdatedata

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.

Specific parameter:
Other general parameters are available.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthsetmenteestatus

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)

Specific parameters:
Other general parameters are available.
state

New status of the mentee (warning: setting this to optout will permanently deletes mentee/mentor relationship)

enabled
Mentorship module is enabled
disabled
Mentorship module is fully disabled. This is normally set by the software and used for A/B testing.
optout
Mentee opted out from mentorship; mentee/mentor relationship will be deleted, mentorship module will be replaced with a possibility to opt back in
This parameter is required.
One of the following values: disabled, enabled, optout
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthsetmentor

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Set user's mentor. Change will be publicly logged.

Specific parameters:
Other general parameters are available.
mentee

Mentee's username

This parameter is required.
Type: user, by username
mentor

Mentor's username

This parameter is required.
Type: user, by username
reason

Reason for the change

Default: (empty)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=growthstarmentee

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Mark or unmark a mentee as starred by current user (stored privately and not logged)

Specific parameters:
Other general parameters are available.
gesaction

Action to take (star or unstar)

This parameter is required.
One of the following values: star, unstar
gesmentee

Mentee to (un)star

This parameter is required.
Type: user, by any of username and user ID (e.g. "#12345")
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=help

Display help for the specified modules.

Specific parameters:
Other general parameters are available.
modules

Modules to display help for (values of the action and format parameters, or main). Can specify submodules with a +.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: main
submodules

Include help for submodules of the named module.

Type: boolean (details)
recursivesubmodules

Include help for submodules recursively.

Type: boolean (details)
wrap

Wrap the output in a standard API response structure.

Type: boolean (details)
toc

Include a table of contents in the HTML output.

Type: boolean (details)

action=helppanelquestionposter

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Handle questions posted via the help panel for the current user.

Specific parameters:
Other general parameters are available.
body

The text of the question provided by the user.

This parameter is required.
Cannot be longer than 2,000 characters.
source

The method by which the question was posted.

helpdesk
The "Ask the help desk" panel
mentor-homepage
The "Ask your mentor" panel on the newcomer homepage
mentor-helppanel
The "Ask your mentor" screen on the help panel
helppanel
The "Ask the help desk" panel (old name)
homepage-mentorship
The "Ask your mentor" panel on the newcomer homepage (old name)
One of the following values: helpdesk, helppanel, homepage-mentorship, mentor-helppanel, mentor-homepage
Default: helpdesk
relevanttitle

The relevant title, if selected, to include with the question.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=homepagequestionstore

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Obtain formatted questions posted via homepage modules

Specific parameter:
Other general parameters are available.
storage

The storage location of the questions.

This parameter is required.
One of the following values: growthexperiments-helppanel-questions, growthexperiments-mentor-questions

action=imagerotate

This module has been disabled.


action=import

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Import a page from another wiki, or from an XML file.

Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending a file for the xml parameter.

Specific parameters:
Other general parameters are available.
summary

Log entry import summary.

xml

Uploaded XML file.

Must be posted as a file upload using multipart/form-data.
interwikiprefix

For uploaded imports: interwiki prefix to apply to unknown usernames (and known users if assignknownusers is set).

interwikisource

For interwiki imports: wiki to import from.

One of the following values: commons, de, es, fr, it, meta, nost, outreachwiki, pl, test2wiki
interwikipage

For interwiki imports: page to import.

fullhistory

For interwiki imports: import the full history, not just the current version.

Type: boolean (details)
templates

For interwiki imports: import all included templates as well.

Type: boolean (details)
namespace

Import to this namespace. Cannot be used together with rootpage.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
assignknownusers

Assign edits to local users where the named user exists locally.

Type: boolean (details)
rootpage

Import as subpage of this page. Cannot be used together with namespace.

tags

Change tags to apply to the entry in the import log and to the dummy revision on the imported pages.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=jsonconfig

Allows direct access to JsonConfig subsystem.

Specific parameters:
Other general parameters are available.
command

Which sub-action to perform on JsonConfig:

status
Shows JsonConfig configuration.
reset
Clears configurations from cache. Requires title parameter and jsonconfig-flush right.
reload
Reloads and caches configurations from config store. Requires title parameter and jsonconfig-reset right.
One of the following values: reload, reset, status
Default: status
namespace

Namespace number of the title to process.

Type: integer
title

Title to process without namespace prefix.

Default: (empty)

action=jsondata

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: JsonConfig
  • License: GPL-2.0-or-later

Retrieve localized JSON data.

Specific parameter:
Other general parameters are available.
title

Title to get. By default assumes namespace to be "Data:"

This parameter is required.
Examples:
Get JSON content of the Sample.tab page, localized to user's language
api.php?action=jsondata&formatversion=2&format=jsonfm&title=Sample.tab [open in sandbox]
Get JSON content of the Sample.tab page localized to French
api.php?action=jsondata&formatversion=2&format=jsonfm&title=Sample.tab&uselang=fr [open in sandbox]

action=jsontransform

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: JsonConfig
  • License: GPL-2.0-or-later

Retrieve JSON data transformed by a Lua function.

Specific parameters:
Other general parameters are available.
title

Title to process without namespace prefix.

This parameter is required.
jtmodule

Name of Lua module to load transform code from. Defaults to Module: namespace.

This parameter is required.
jtfunction

Name of Lua function to run

This parameter is required.
jtargs

Sequence of strings to pass as arguments to the Lua transform function

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=languagesearch

Search for language names in any script.

Specific parameters:
Other general parameters are available.
search

Search string.

This parameter is required.
typos

Number of spelling mistakes allowed in the search string.

Type: integer
Default: 1

action=linkaccount (link)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Link an account from a third-party provider to the current user.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=link, and a csrf token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying linkreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with linkcontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to linkreturnurl. Then post to this module with linkcontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
linkrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=link or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
linkmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
linkmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
linkreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or linkcontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a linkcontinue request to this API module.

linkcontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or linkreturnurl is required.

Type: boolean (details)
linktoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=link (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=login (lg)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log in and get authentication cookies.

This action should only be used in combination with Special:BotPasswords; use for main-account login is deprecated and may fail without warning. To safely log in to the main account, use action=clientlogin.

Specific parameters:
Other general parameters are available.
lgname

Username.

lgpassword

Password.

lgdomain

Domain (optional).

lgtoken

A "login" token retrieved from action=query&meta=tokens

action=logout

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log out and clear session data.

Specific parameters:
Other general parameters are available.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
checkuserclienthints

Client hints data supplied alongside requests to ApiLogout. For internal use only.

Example:
Log the current user out.
api.php?action=logout&token=123ABC [open in sandbox]

action=managetags

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform management tasks relating to change tags.

Specific parameters:
Other general parameters are available.
operation

Which operation to perform:

create
Create a new change tag for manual use.
delete
Remove a change tag from the database, including removing the tag from all revisions, recent change entries and log entries on which it is used.
activate
Activate a change tag, allowing users to apply it manually.
deactivate
Deactivate a change tag, preventing users from applying it manually.
This parameter is required.
One of the following values: activate, create, deactivate, delete
tag

Tag to create, delete, activate or deactivate. For tag creation, the tag must not exist. For tag deletion, the tag must exist. For tag activation, the tag must exist and not be in use by an extension. For tag deactivation, the tag must be currently active and manually defined.

This parameter is required.
reason

An optional reason for creating, deleting, activating or deactivating the tag.

Default: (empty)
ignorewarnings

Whether to ignore any warnings that are issued during the operation.

Type: boolean (details)
tags

Change tags to apply to the entry in the tag management log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=massmessage

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MassMessage
  • License: GPL-2.0-or-later

Send a message to a list of pages.

Specific parameters:
Other general parameters are available.
spamlist

Page containing list of pages to leave a message on.

This parameter is required.
subject

Subject line of the message.

This parameter is required.
message

Message body text.

page-message

Page to be sent along with the message body.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Send a message to the list at Signpost Spamlist with the subject "New Signpost", and message body of "Please read it".
api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&message=Please%20read%20it&token=TOKEN [open in sandbox]
Send a message to the list at Signpost Spamlist with the subject "New Signpost", and the message as the content of the page "Help Page".
api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&page-message=Help_Page&token=TOKEN [open in sandbox]
Send a message to the list at Signpost Spamlist with the subject "New Signpost", and message body of "Please read it" appended with the content from page "Help Page".
api.php?action=massmessage&spamlist=Signpost%20Spamlist&subject=New%20Signpost&message=Please%20read%20it&page-message=Help_Page&token=TOKEN [open in sandbox]

action=mergehistory

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Merge page histories.

Specific parameters:
Other general parameters are available.
from

Title of the page from which history will be merged. Cannot be used together with fromid.

fromid

Page ID of the page from which history will be merged. Cannot be used together with from.

Type: integer
to

Title of the page to which history will be merged. Cannot be used together with toid.

toid

Page ID of the page to which history will be merged. Cannot be used together with to.

Type: integer
timestamp

Timestamp up to which revisions will be moved from the source page's history to the destination page's history. If omitted, the entire page history of the source page will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.

reason

Reason for the history merge.

Default: (empty)
starttimestamp

Timestamp from which revisions will be moved from the source page's history to the destination page's history. If omitted, all revisions before the timestamp parameter (or the entire history if neither are specified) will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=move

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Move a page.

Specific parameters:
Other general parameters are available.
from

Title of the page to rename. Cannot be used together with fromid.

fromid

Page ID of the page to rename. Cannot be used together with from.

Type: integer
to

Title to rename the page to.

This parameter is required.
reason

Reason for the rename.

Default: (empty)
movetalk

Rename the talk page, if it exists.

Type: boolean (details)
movesubpages

Rename subpages, if applicable.

Type: boolean (details)
noredirect

Don't create a redirect.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
ignorewarnings

Ignore any warnings.

Type: boolean (details)
tags

Change tags to apply to the entry in the move log and to the dummy revision on the destination page.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=opensearch

Search the wiki using the OpenSearch protocol.

Specific parameters:
Other general parameters are available.
search

Search string.

This parameter is required.
namespace

Namespaces to search. Ignored if search begins with a valid namespace prefix.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: 0
limit

Maximum number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
profile

Search profile to use.

strict
Strict profile with few punctuation characters removed but diacritics and stress marks are kept.
normal
Few punctuation characters, some diacritics and stopwords removed.
fuzzy
Similar to normal with typo correction (two typos supported).
fast-fuzzy
Experimental fuzzy profile (may be removed at any time)
classic
Classic prefix, few punctuation characters and some diacritics removed.
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: classic, engine_autoselect, fast-fuzzy, fuzzy, normal, strict
Default: engine_autoselect
suggest
Deprecated.

No longer used.

Type: boolean (details)
redirects

How to handle redirects:

return
Return the redirect itself.
resolve
Return the target page. May return fewer than limit results.

For historical reasons, the default is "return" for format=json and "resolve" for other formats.

One of the following values: resolve, return
format

The format of the output.

One of the following values: json, jsonfm, xml, xmlfm
Default: json
warningsaserror

If warnings are raised with format=json, return an API error instead of ignoring them.

Type: boolean (details)
Example:
Find pages beginning with Te.
api.php?action=opensearch&search=Te [open in sandbox]

action=options

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change preferences of the current user.

Only options which are registered in core or in one of installed extensions, or options with keys prefixed with userjs- (intended to be used by user scripts), can be set.

Specific parameters:
Other general parameters are available.
reset

Resets preferences to the site defaults.

Type: boolean (details)
resetkinds

List of types of options to reset when the reset option is set.

Values (separate with | or alternative): all, local-exception, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
Default: all
change

List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., optionname|otheroption|..., the option will be reset to its default value. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
optionname

The name of the option that should be set to the value given by optionvalue.

optionvalue

The value for the option specified by optionname. When optionname is set but optionvalue is omitted, the option will be reset to its default value.

global

What to do if the option was set globally using the GlobalPreferences extension.

  • ignore: Do nothing. The option remains with its previous value.
  • override: Add a local override.
  • update: Update the option globally.
  • create: Set the option globally, overriding any local value.
One of the following values: create, ignore, override, update
Default: ignore
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=pagetriageaction

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: PageTriage
  • License: MIT

Mark an article as reviewed or unreviewed.

Specific parameters:
Other general parameters are available.
pageid

ID for the page that the action is performed on.

This parameter is required.
Type: integer
reviewed

Whether the page should be marked as reviewed

One of the following values: 0, 1
enqueue

Whether the page should be added to PageTriage queue.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
note

Personal note to page creators from reviewers.

skipnotif

Whether to skip notification.

Type: boolean (details)
tags

Change tags to apply to the log entries generated for this action.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle

action=pagetriagelist

  • This module requires read rights.
  • Source: PageTriage
  • License: MIT

Get a list of page IDs for building a PageTriage queue.

Specific parameters:
Other general parameters are available.
show_predicted_class_stub

Whether to include predicted class stub

Type: boolean (details)
show_predicted_class_start

Whether to include predicted class start

Type: boolean (details)
show_predicted_class_c

Whether to include predicted class C

Type: boolean (details)
show_predicted_class_b

Whether to include predicted class B

Type: boolean (details)
show_predicted_class_good

Whether to include predicted class good

Type: boolean (details)
show_predicted_class_featured

Whether to included predicted class featured

Type: boolean (details)
show_predicted_issues_vandalism

Whether to include potential issues of vandalism

Type: boolean (details)
show_predicted_issues_spam

Whether to include potential issues of spam

Type: boolean (details)
show_predicted_issues_attack

Whether to include potential issues of attack

Type: boolean (details)
show_predicted_issues_none

Whether to include no potential issues

Type: boolean (details)
show_predicted_issues_copyvio

Whether to include potential issues of copyvio

Type: boolean (details)
showbots

Whether to show only bot edits.

Type: boolean (details)
showautopatrolled

Whether to show only edits by users with the autopatrol user right.

Type: boolean (details)
showredirs

Whether to include redirects.

Type: boolean (details)
showothers

Whether to include pages that are not redirects nor nominated for deletion.

Type: boolean (details)
showreviewed

Whether to include reviewed.

Type: boolean (details)
showunreviewed

Whether to include unreviewed.

Type: boolean (details)
showdeleted

Whether to include "proposed for deletion".

Type: boolean (details)
namespace

What namespace to pull pages from.

Type: integer
afc_state

Which Articles-for-Creation state to show.

Type: integer
no_category

Whether to show only pages with no category.

Type: boolean (details)
unreferenced

Whether to show only pages without any references.

Type: boolean (details)
no_inbound_links

Whether to show only pages with no inbound links.

Type: boolean (details)
recreated

Whether to show only pages that were previously deleted.

Type: boolean (details)
non_autoconfirmed_users

Whether to show only pages created by non autoconfirmed users.

Type: boolean (details)
learners

Whether to show only pages created by newly autoconfirmed users.

Type: boolean (details)
blocked_users

Whether to show only pages created by blocked users.

Type: boolean (details)
username

Show only pages created by username.

Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
keyword

Show only pages with this keyword in the snippet.

date_range_from

Show only pages created on this date and after.

Type: timestamp (allowed formats)
date_range_to

Show only pages created on this date and before.

Type: timestamp (allowed formats)
page_id

Return data for the specified page IDs, ignoring other parameters.

Type: integer
limit

The maximum number of results to return.

Type: integer
The value must be between 1 and 200.
Default: 20
offset

Timestamp to start from.

Type: integer
pageoffset

Page ID to start from (requires offset param to be passed as well).

Type: integer
dir

The direction the list should be sorted in - oldestfirst, newestfirst, oldestreview or newestreview.

One of the following values: newestfirst, newestreview, oldestfirst, oldestreview

action=pagetriagestats

  • This module requires read rights.
  • Source: PageTriage
  • License: MIT

Get the stats for page triage.

Specific parameters:
Other general parameters are available.
show_predicted_class_stub

Whether to include predicted class stub

Type: boolean (details)
show_predicted_class_start

Whether to include predicted class start

Type: boolean (details)
show_predicted_class_c

Whether to include predicted class C

Type: boolean (details)
show_predicted_class_b

Whether to include predicted class B

Type: boolean (details)
show_predicted_class_good

Whether to include predicted class good

Type: boolean (details)
show_predicted_class_featured

Whether to included predicted class featured

Type: boolean (details)
show_predicted_issues_vandalism

Whether to include potential issues of vandalism

Type: boolean (details)
show_predicted_issues_spam

Whether to include potential issues of spam

Type: boolean (details)
show_predicted_issues_attack

Whether to include potential issues of attack

Type: boolean (details)
show_predicted_issues_none

Whether to include no potential issues

Type: boolean (details)
show_predicted_issues_copyvio

Whether to include potential issues of copyvio

Type: boolean (details)
showbots

Whether to include only pages created by bots.

Type: boolean (details)
showautopatrolled

Whether to show only edits by users with the autopatrol user right.

Type: boolean (details)
showredirs

Whether to include redirects.

Type: boolean (details)
showothers

Whether to include normal pages that are not redirects nor nominated for deletion.

Type: boolean (details)
showreviewed

Whether to include reviewed.

Type: boolean (details)
showunreviewed

Whether to include unreviewed.

Type: boolean (details)
showdeleted

Whether to include "proposed for deletion".

Type: boolean (details)
namespace

What namespace to pull stats from.

Type: integer
afc_state

Which Articles-for-Creation state to get stats for.

Type: integer
no_category

Whether to include only pages with no category.

Type: boolean (details)
unreferenced

Whether to include only pages with no references.

Type: boolean (details)
no_inbound_links

Whether to include only pages with no inbound links.

Type: boolean (details)
recreated

Whether to include only pages that were previously deleted.

Type: boolean (details)
non_autoconfirmed_users

Whether to include only pages created by non-autoconfirmed users.

Type: boolean (details)
learners

Whether to include only pages created by newly autoconfirmed users.

Type: boolean (details)
blocked_users

Whether to include only pages created by blocked users.

Type: boolean (details)
username

Include only pages created by username.

Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
keyword

Include only pages with this keyword in the snippet.

date_range_from

Include only pages created on this date and after.

Type: timestamp (allowed formats)
date_range_to

Include only pages created on this date and before.

Type: timestamp (allowed formats)

action=pagetriagetagcopyvio

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: PageTriage
  • License: MIT

Tag a revision as a likely copyright violation.

The revision is shown on Special:NewPagesFeed. Requires the pagetriage-copyvio right.

Specific parameters:
Other general parameters are available.
revid

Revision ID to tag as a likely copyright violation

This parameter is required.
Type: integer
untag

Remove the copyright violation tag

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=pagetriagetagging

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: PageTriage
  • License: MIT

Add tags to an article.

Specific parameters:
Other general parameters are available.
pageid

The article for which to be tagged.

This parameter is required.
Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
wikitext

The wikitext containing the tag added to the article.

This parameter is required.
deletion

Whether or not the tagging is for a deletion nomination.

Type: boolean (details)
note

Personal note to page creators from reviewers.

Default: (empty)
taglist

Pipe-separated list of tags.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=paraminfo

Obtain information about API modules.

Specific parameters:
Other general parameters are available.
modules

List of module names (values of the action and format parameters, or main). Can specify submodules with a +, or all submodules with +*, or all submodules recursively with +**.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
helpformat

Format of help strings.

One of the following values: html, none, raw, wikitext
Default: none
querymodules
Deprecated.

List of query module names (value of prop, meta or list parameter). Use modules=query+foo instead of querymodules=foo.

Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allmessages, allpages, allredirects, allrevisions, alltransclusions, allusers, authmanagerinfo, automatictranslationdenselanguages, babel, backlinks, betafeatures, blocks, categories, categoryinfo, categorymembers, centralnoticeactivecampaigns, centralnoticelogs, checkuser, checkuserformattedblockinfo, checkuserlog, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, codexicons, communityconfiguration, contenttranslation, contenttranslationcorpora, contenttranslationfavoritesuggestions, contributors, coordinates, cxconfig, cxdeletedtranslations, cxpublishedtranslations, cxtranslatorstats, deletedrevisions, deletedrevs, description, duplicatefiles, embeddedin, extlinks, extracts, exturlusage, featureusage, filearchive, filerepoinfo, fileusage, flagged, gadgetcategories, gadgets, geosearch, globalallusers, globalblocks, globalgroups, globalpreferences, globalrenamestatus, globalusage, globaluserinfo, globalusers, growthimagesuggestiondata, growthmenteestatus, growthmentorlist, growthmentormentee, growthmentorstatus, growthnextsuggestedtasktype, growthstarredmentees, growthtasks, imageinfo, images, imageusage, info, isreviewed, iwbacklinks, iwlinks, langbacklinks, langlinks, langlinkscount, languageinfo, links, linkshere, linterrors, linterstats, logevents, mapdata, mmcontent, mostviewed, mystashedfiles, notifications, oldreviewedpages, ores, pageassessments, pagecollectionsmetadata, pageimages, pagepropnames, pageprops, pageswithprop, pageterms, pageviews, prefixsearch, projectpages, projects, protectedtitles, querypage, random, readinglistentries, readinglists, recentchanges, redirects, revisions, search, siteinfo, siteviews, stashimageinfo, tags, templates, tokens, trackingcategories, transcludedin, transcodestatus, unreadnotificationpages, usercontribs, userinfo, users, videoinfo, watchlist, watchlistraw, wbentityusage, wblistentityusage, wikibase, wikisets
Maximum number of values is 50 (500 for clients that are allowed higher limits).
mainmodule
Deprecated.

Get information about the main (top-level) module as well. Use modules=main instead.

pagesetmodule
Deprecated.

Get information about the pageset module (providing titles= and friends) as well.

formatmodules
Deprecated.

List of format module names (value of format parameter). Use modules instead.

Values (separate with | or alternative): json, jsonfm, none, rawfm, xml, xmlfm

action=parse

Parses content and returns parser output.

See the various prop-modules of action=query to get information from the current version of a page.

There are several ways to specify the text to parse:

  1. Specify a page or revision, using page, pageid, or oldid.
  2. Specify content explicitly, using text, title, revid, and contentmodel.
  3. Specify only a summary to parse. prop should be given an empty value.
Specific parameters:
Other general parameters are available.
title

Title of page the text belongs to. If omitted, contentmodel must be specified, and API will be used as the title.

text

Text to parse. Use title or contentmodel to control the content model.

revid

Revision ID, for {{REVISIONID}} and similar variables.

Type: integer
summary

Summary to parse.

page

Parse the content of this page. Cannot be used together with text and title.

pageid

Parse the content of this page. Overrides page.

Type: integer
redirects

If page or pageid is set to a redirect, resolve it.

Type: boolean (details)
oldid

Parse the content of this revision. Overrides page and pageid.

Type: integer
prop

Which pieces of information to get:

text
Gives the parsed text of the wikitext.
langlinks
Gives the language links in the parsed wikitext.
categories
Gives the categories in the parsed wikitext.
categorieshtml
Gives the HTML version of the categories.
links
Gives the internal links in the parsed wikitext.
templates
Gives the templates in the parsed wikitext.
images
Gives the images in the parsed wikitext.
externallinks
Gives the external links in the parsed wikitext.
sections
Deprecated. prop=sections has been deprecated. Please use prop=tocdata instead.
Gives the sections in the parsed wikitext.
tocdata
Gives the table of contents information in the parsed wikitext. See mw:API:Parsing_wikitext/TOCData for schema.
revid
Adds the revision ID of the parsed page.
displaytitle
Adds the title of the parsed wikitext.
subtitle
Adds the page subtitle for the parsed page.
headhtml
Gives parsed doctype, opening <html>, <head> element and opening <body> of the page.
modules
Gives the ResourceLoader modules used on the page. To load, use mw.loader.using(). Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
jsconfigvars
Gives the JavaScript configuration variables specific to the page. To apply, use mw.config.set().
encodedjsconfigvars
Gives the JavaScript configuration variables specific to the page as a JSON string.
indicators
Gives the HTML of page status indicators used on the page.
iwlinks
Gives interwiki links in the parsed wikitext.
wikitext
Gives the original wikitext that was parsed.
properties
Gives various properties defined in the parsed wikitext.
limitreportdata
Gives the limit report in a structured way. Gives no data, when disablelimitreport is set.
limitreporthtml
Gives the HTML version of the limit report. Gives no data, when disablelimitreport is set.
parsetree
The XML parse tree of revision content (requires content model wikitext)
parsewarnings
Gives the warnings that occurred while parsing content (as wikitext).
parsewarningshtml
Gives the warnings that occurred while parsing content (as HTML).
headitems
Deprecated. prop=headitems is deprecated since MediaWiki 1.28. Use prop=headhtml when creating new HTML documents, or prop=modules|jsconfigvars when updating a document client-side.
Gives items to put in the <head> of the page.
Values (separate with | or alternative): categories, categorieshtml, displaytitle, encodedjsconfigvars, externallinks, headhtml, images, indicators, iwlinks, jsconfigvars, langlinks, limitreportdata, limitreporthtml, links, modules, parsetree, parsewarnings, parsewarningshtml, properties, revid, subtitle, templates, text, tocdata, wikitext, headitems, sections
Default: text|langlinks|categories|links|templates|images|externallinks|sections|tocdata|revid|displaytitle|iwlinks|properties|parsewarnings
wrapoutputclass

CSS class to use to wrap the parser output.

Default: mw-parser-output
usearticle

Use the ArticleParserOptions hook to ensure the options used match those used for article page views

Type: boolean (details)
parsoid
Deprecated.

Generate HTML conforming to the MediaWiki DOM spec using Parsoid. Replaced by parser=parsoid.

Type: boolean (details)
parser

Which wikitext parser to use:

parsoid
Generate HTML conforming to the MediaWiki DOM spec using Parsoid.
default
Generate HTML using this wiki's default parser.
legacy
Generate HTML using the legacy parser.
One of the following values: default, legacy, parsoid
Default: default
pst

Do a pre-save transform on the input before parsing it. Only valid when used with text.

Type: boolean (details)
onlypst

Do a pre-save transform (PST) on the input, but don't parse it. Returns the same wikitext, after a PST has been applied. Only valid when used with text.

Type: boolean (details)
effectivelanglinks
Deprecated.

Includes language links supplied by extensions (for use with prop=langlinks).

Type: boolean (details)
section

Only parse the content of the section with this identifier.

When new, parse text and sectiontitle as if adding a new section to the page.

new is allowed only when specifying text.

sectiontitle

New section title when section is new.

Unlike page editing, this does not fall back to summary when omitted or empty.

disablepp
Deprecated.

Use disablelimitreport instead.

Type: boolean (details)
disablelimitreport

Omit the limit report ("NewPP limit report") from the parser output.

Type: boolean (details)
disableeditsection

Omit edit section links from the parser output.

Type: boolean (details)
disablestylededuplication

Do not deduplicate inline stylesheets in the parser output.

Type: boolean (details)
showstrategykeys

Whether to include internal merge strategy information in jsconfigvars.

Type: boolean (details)
generatexml
Deprecated.

Generate XML parse tree (requires content model wikitext; replaced by prop=parsetree).

Type: boolean (details)
preview

Parse in preview mode.

Type: boolean (details)
sectionpreview

Parse in section preview mode (enables preview mode too).

Type: boolean (details)
disabletoc

Omit table of contents in output.

Type: boolean (details)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
contentformat

Content serialization format used for the input text. Only valid when used with text.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
contentmodel

Content model of the input text. If omitted, title must be specified, and default will be the model of the specified title. Only valid when used with text.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
mobileformat

Return parse output in a format suitable for mobile devices.

Type: boolean (details)
templatesandboxprefix

Template sandbox prefix, as with Special:TemplateSandbox.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
templatesandboxtitle

Parse the page using templatesandboxtext in place of the contents of the page named here.

templatesandboxtext

Parse the page using this page content in place of the page named by templatesandboxtitle.

templatesandboxcontentmodel

Content model of templatesandboxtext.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
templatesandboxcontentformat

Content format of templatesandboxtext.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown

action=parser-migration

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: ParserMigration
  • License: CC0-1.0

Parse a page with two different parser configurations.

Specific parameters:
Other general parameters are available.
title

The title of the page to load and parse.

This parameter is required.
config

The parser configuration to use. May be "old", "new" or "old|new".

old
Parses the page using the "old" configuration; MediaWiki's legacy parser
new
Parses the page using the "new" configuration; Parsoid
Values (separate with | or alternative): new, old
Default: old|new
redirect

Redirects are followed by default. Use "no" to not follow redirects.

action=patrol

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Patrol a page or revision.

Specific parameters:
Other general parameters are available.
rcid

Recentchanges ID to patrol.

Type: integer
revid

Revision ID to patrol.

Type: integer
tags

Change tags to apply to the entry in the patrol log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "patrol" token retrieved from action=query&meta=tokens

This parameter is required.

action=protect

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the protection level of a page.

Specific parameters:
Other general parameters are available.
title

Title of the page to (un)protect. Cannot be used together with pageid.

pageid

ID of the page to (un)protect. Cannot be used together with title.

Type: integer
protections

List of protection levels, formatted action=level (e.g. edit=sysop). A level of all means everyone is allowed to take the action, i.e. no restriction.

Note: Any actions not listed will have restrictions removed.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
expiry

Expiry timestamps. If only one timestamp is set, it'll be used for all protections. Use infinite, indefinite, infinity, or never, for a never-expiring protection.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: infinite
reason

Reason for (un)protecting.

Default: (empty)
tags

Change tags to apply to the entry in the protection log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
cascade

Enable cascading protection (i.e. protect transcluded templates and images used in this page). Ignored if none of the given protection levels support cascading.

Type: boolean (details)
watch
Deprecated.

If set, add the page being (un)protected to the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=purge

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Purge the cache for the given titles.

Specific parameters:
Other general parameters are available.
forcelinkupdate

Update the links tables and do other secondary data updates.

Type: boolean (details)
forcerecursivelinkupdate

Same as forcelinkupdate, and update the links tables for any page that uses this page as a template.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
geosearch
Returns pages having coordinates that are located in a certain area.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
oldreviewedpages
Enumerates pages that have changes pending review.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)

action=query

Fetch data from and about MediaWiki.

All data modifications will first have to use query to acquire a token to prevent abuse from malicious sites.

Specific parameters:
Other general parameters are available.
prop

Which properties to get for the queried pages.

categories
List all categories the pages belong to.
categoryinfo
Returns information about the given categories.
contributors
Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
coordinates
Returns coordinates of the given pages.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
extlinks
Returns all external URLs (not interwikis) from the given pages.
extracts
Returns plain-text or limited HTML extracts of the given pages.
fileusage
Find all pages that use the given files.
flagged
Get information about the flagging status of the given pages.
globalusage
Returns global image usage for a certain image.
growthimagesuggestiondata
Fetch associated image suggestion data, if available
imageinfo
Returns file information and upload history.
images
Returns all files contained on the given pages.
info
Get basic page information.
isreviewed
Determine if a page is marked as reviewed.
iwlinks
Returns all interwiki links from the given pages.
langlinks
Returns all interlanguage links from the given pages.
langlinkscount
Get the number of other language versions.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mmcontent
Get the description and targets of a spamlist
pageassessments
Return associated projects and assessments for the given pages.
pageimages
Returns information about images on the page, such as thumbnail and presence of photos.
pageprops
Get various page properties defined in the page content.
pageterms
Get the Wikidata terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
pageviews
Shows per-page pageview data (the number of daily pageviews for each of the last pvipdays days).
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
stashimageinfo
Returns file information for stashed files.
templates
Returns all pages transcluded on the given pages.
transcludedin
Find all pages that transclude the given pages.
transcodestatus
Get transcode status for a given file page.
videoinfo
Extends imageinfo to include video source (derivatives) information
wbentityusage
Returns all entity IDs used in the given pages.
cirrusbuilddoc
Internal. Dump of a CirrusSearch article document from the database servers
cirruscompsuggestbuilddoc
Internal. Dump of the document used by the completion suggester
cirrusdoc
Internal. Dump of a CirrusSearch article document from the search servers
description
Internal. Get a short description a.k.a. subtitle explaining what the target page is about.
mapdata
Internal. Request all Kartographer map data for the given pages
Values (separate with | or alternative): categories, categoryinfo, contributors, coordinates, deletedrevisions, duplicatefiles, extlinks, extracts, fileusage, flagged, globalusage, growthimagesuggestiondata, imageinfo, images, info, isreviewed, iwlinks, langlinks, langlinkscount, links, linkshere, mmcontent, pageassessments, pageimages, pageprops, pageterms, pageviews, redirects, revisions, stashimageinfo, templates, transcludedin, transcodestatus, videoinfo, wbentityusage, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, description, mapdata
list

Which lists to get.

abusefilters
Show details of the edit filters.
abuselog
Show events that were caught by one of the edit filters.
allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
allusers
Enumerate all registered users.
automatictranslationdenselanguages
Fetch the list of sitelinks for the article that corresponds to a given Wikidata ID, ordered by article size.
backlinks
Find all pages that link to the given page.
betafeatures
List all BetaFeatures
blocks
List all blocked users and IP addresses.
categorymembers
List all pages in a given category.
centralnoticeactivecampaigns
Get a list of currently active campaigns with start and end dates and associated banners.
centralnoticelogs
Get a log of campaign configuration changes.
checkuserlog
Get entries from the CheckUser log.
codexicons
Get Codex icons
contenttranslation
Query Content Translation database for translations.
contenttranslationcorpora
Get the section-aligned parallel text for a given translation. See also list=cxpublishedtranslations. Dumps are provided in different formats for high volume access.
contenttranslationfavoritesuggestions
Get user's favorite suggestions for Content Translation.
cxpublishedtranslations
Fetch all published translations information.
cxtranslatorstats
Fetch the translation statistics for the given user.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
filearchive
Enumerate all deleted files sequentially.
gadgetcategories
Returns a list of gadget sections.
gadgets
Returns a list of gadgets used on this wiki.
geosearch
Returns pages having coordinates that are located in a certain area.
globalallusers
Enumerate all global users.
globalblocks
List all globally blocked IP addresses.
globalgroups
Enumerate all global groups.
globalusers
Get information about a list of global users.
growthmentorlist
List all the mentors
growthmentormentee
Get all mentees assigned to a given mentor
growthstarredmentees
Get list of mentees starred by the currently logged in mentor
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
linterrors
Get a list of lint errors
logevents
Get events from logs.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
mystashedfiles
Get a list of files in the current user's upload stash.
oldreviewedpages
Enumerates pages that have changes pending review.
pagecollectionsmetadata
Fetch page collection information for the given title.
pagepropnames
List all page property names in use on the wiki.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
projects
List all the projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
search
Perform a full text search.
tags
List change tags.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
usercontribs
Get all edits by a user.
users
Get information about a list of users.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wikisets
Enumerate all wiki sets.
checkuser
Deprecated. This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
deletedrevs
Deprecated. list=deletedrevs has been deprecated. Please use prop=deletedrevisions or list=alldeletedrevisions instead.
List deleted revisions.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, allusers, automatictranslationdenselanguages, backlinks, betafeatures, blocks, categorymembers, centralnoticeactivecampaigns, centralnoticelogs, checkuserlog, codexicons, contenttranslation, contenttranslationcorpora, contenttranslationfavoritesuggestions, cxpublishedtranslations, cxtranslatorstats, embeddedin, exturlusage, filearchive, gadgetcategories, gadgets, geosearch, globalallusers, globalblocks, globalgroups, globalusers, growthmentorlist, growthmentormentee, growthstarredmentees, imageusage, iwbacklinks, langbacklinks, linterrors, logevents, mostviewed, mystashedfiles, oldreviewedpages, pagecollectionsmetadata, pagepropnames, pageswithprop, prefixsearch, projectpages, projects, protectedtitles, querypage, random, recentchanges, search, tags, trackingcategories, usercontribs, users, watchlist, watchlistraw, wblistentityusage, wikisets, checkuser, deletedrevs, growthtasks, readinglistentries
Maximum number of values is 50 (500 for clients that are allowed higher limits).
meta

Which metadata to get.

allmessages
Return messages from this site.
authmanagerinfo
Retrieve information about the current authentication status.
babel
Get information about what languages the user knows
communityconfiguration
Read the community configuration
cxconfig
Get ContentTranslation local configuration settings.
featureusage
Get a summary of logged API feature usages for a user agent.
filerepoinfo
Return meta information about image repositories configured on the wiki.
globalpreferences
Retrieve global preferences for the current user.
globalrenamestatus
Show information about global renames that are in progress.
globaluserinfo
Show information about a global user.
growthmenteestatus
Query current user's mentee status; see documentation of action=growthsetmenteestatus for detailed information about individual statuses.
growthmentorstatus
Query current user's mentor status
languageinfo
Return information about available languages.
linterstats
Get number of lint errors in each category
notifications
Get notifications waiting for the current user.
ores
Return ORES configuration and model data for this wiki.
siteinfo
Return general information about the site.
siteviews
Shows sitewide pageview data (daily pageview totals for each of the last pvisdays days).
tokens
Gets tokens for data-modifying actions.
unreadnotificationpages
Get pages for which there are unread notifications for the current user.
userinfo
Get information about the current user.
wikibase
Get information about the Wikibase client and the associated Wikibase repository.
checkuserformattedblockinfo
Internal. Return formatted block details for sitewide blocks affecting the current user.
cxdeletedtranslations
Internal. Get the number of your published translations that were deleted.
growthnextsuggestedtasktype
Internal. Get a suggested task type for a user to try next.
readinglists
Internal. List or filter the user's reading lists and show metadata about them.
Values (separate with | or alternative): allmessages, authmanagerinfo, babel, communityconfiguration, cxconfig, featureusage, filerepoinfo, globalpreferences, globalrenamestatus, globaluserinfo, growthmenteestatus, growthmentorstatus, languageinfo, linterstats, notifications, ores, siteinfo, siteviews, tokens, unreadnotificationpages, userinfo, wikibase, checkuserformattedblockinfo, cxdeletedtranslations, growthnextsuggestedtasktype, readinglists
indexpageids

Include an additional pageids section listing all returned page IDs.

Type: boolean (details)
export

Export the current revisions of all given or generated pages.

Type: boolean (details)
exportnowrap

Return the export XML without wrapping it in an XML result (same format as Special:Export). Can only be used with query+export.

Type: boolean (details)
exportschema

Target the given version of the XML dump format when exporting. Can only be used with query+export.

One of the following values: 0.10, 0.11
Default: 0.11
iwurl

Whether to get the full URL if the title is an interwiki link.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

rawcontinue

Return raw query-continue data for continuation.

Type: boolean (details)
titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
geosearch
Returns pages having coordinates that are located in a certain area.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
oldreviewedpages
Enumerates pages that have changes pending review.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
redirects

Automatically resolve redirects in query+titles, query+pageids, and query+revids, and in pages returned by query+generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)

prop=categories (cl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all categories the pages belong to.

Specific parameters:
Other general parameters are available.
clprop

Which additional properties to get for each category:

sortkey
Adds the sortkey (hexadecimal string) and sortkey prefix (human-readable part) for the category.
timestamp
Adds timestamp of when the category was added.
hidden
Tags categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, sortkey, timestamp
clshow

Which kind of categories to show.

Values (separate with | or alternative): !hidden, hidden
cllimit

How many categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
clcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

clcategories

Only list these categories. Useful for checking whether a certain page is in a certain category.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
cldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
Get a list of categories the page Albert Einstein belongs to.
api.php?action=query&prop=categories&titles=Albert%20Einstein [open in sandbox]
Get information about all categories used in the page Albert Einstein.
api.php?action=query&generator=categories&titles=Albert%20Einstein&prop=info [open in sandbox]

prop=categoryinfo (ci)

Returns information about the given categories.

Specific parameter:
Other general parameters are available.
cicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Get information about Category:Foo and Category:Bar.
api.php?action=query&prop=categoryinfo&titles=Category:Foo|Category:Bar [open in sandbox]

prop=cirrusbuilddoc (cb)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of a CirrusSearch article document from the database servers

Specific parameters:
Other general parameters are available.
cbbuilders

Type of data to extract

Values (separate with | or alternative): content, links
Default: content|links
cblimiterprofile

Profile to use when limiting the size of the document

Example:
Get a dump of a single CirrusSearch article generated from the database.
api.php?action=query&prop=cirrusbuilddoc&titles=Main_Page [open in sandbox]

prop=cirruscompsuggestbuilddoc (csb)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of the document used by the completion suggester

Specific parameter:
Other general parameters are available.
csbmethod

Provide a score method name to be used by the completion suggester

Default: popqual

prop=cirrusdoc (cd)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of a CirrusSearch article document from the search servers

Specific parameter:
Other general parameters are available.
cdincludes

Define which fields should be returned by the search.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: all
Examples:
Get a dump of a single CirrusSearch article as currently indexed into search.
api.php?action=query&prop=cirrusdoc&titles=Main_Page [open in sandbox]
Get a dump of CirrusSearch settings for this wiki with just the Categories that have been selected using the 'includes' parameter
api.php?action=query&prop=cirrusdoc&titles=Main_Page&cdincludes=category [open in sandbox]

prop=contributors (pc)

Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.

Specific parameters:
Other general parameters are available.
pcgroup

Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
pcexcludegroup

Exclude users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
pcrights

Only include users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, collectionsaveascommunitypage, collectionsaveasuserpage, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, patrol, patrolmarks, protect, read, renameuser, renameuser-global, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pcexcluderights

Exclude users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, collectionsaveascommunitypage, collectionsaveasuserpage, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, patrol, patrolmarks, protect, read, renameuser, renameuser-global, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pclimit

How many contributors to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
pccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=coordinates (co)

  • This module requires read rights.
  • Source: GeoData
  • License: WTFPL

Returns coordinates of the given pages.

Specific parameters:
Other general parameters are available.
colimit

How many coordinates to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
cocontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

coprop

Which additional coordinate properties to return. (Properties that are always returned: lat, lon, and either primary or secondary as a boolean flag.)

type
Type of the object the coordinates point to. See mw:Special:MyLanguage/Extension:GeoData#Usage for details.
name
Name of the object.
dim
Approximate size of the object in meters.
country
ISO 3166-1 alpha-2 country code (e.g. US or RU).
region
ISO 3166-2 region code (the part of the ISO 3166-2 code after the dash; e.g. FL or MOS).
globe
Which terrestrial body the coordinates are relative to (e.g. moon or pluto). Defaults to Earth. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.
Values (separate with | or alternative): country, dim, globe, name, region, type
Default: globe
coprimary

Which kind of coordinates to return.

primary
The location of the subject of the article. There is at most one primary coordinate per title.
secondary
The location of some object that's mentioned in the article. Any number of secondary coordinates can be associated with a title.
all
Return both primary and secondary coordinates.
One of the following values: all, primary, secondary
Default: primary
codistancefrompoint

Return distance in meters from the geographical coordinates of every valid result from the given coordinates.

Format: Latitude and longitude separated by pipe (|).

codistancefrompage

Return distance in meters from the geographical coordinates of every valid result from the coordinates of this page.

prop=deletedrevisions (drv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get deleted revision information.

May be used in several ways:

  1. Get deleted revisions for a set of pages, by setting titles or pageids. Ordered by title and timestamp.
  2. Get data about a set of deleted revisions by setting their IDs with revids. Ordered by revision ID.
Specific parameters:
Other general parameters are available.
drvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, drvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, drvlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
drvslots

Which revision slots to return data for, when slot-related properties are included in drvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
drvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of drvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
drvlimit

Limit how many revisions will be returned. If drvprop=content, drvprop=parsetree, drvdiffto or drvdifftotext is used, the limit is 50. If drvparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
drvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires drvprop=content).

Type: boolean (details)
drvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires drvprop=content).

Type: boolean (details)
drvparse
Deprecated.

Use action=parse instead. Parse revision content (requires drvprop=content). For performance reasons, if this option is used, drvlimit is enforced to 1.

Type: boolean (details)
drvsection

Only retrieve the content of the section with this identifier.

drvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, drvlimit is enforced to 50.

drvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides drvdiffto. If drvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, drvlimit is enforced to 50.

drvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with drvdifftotext.

Type: boolean (details)
drvcontentformat
Deprecated.

Serialization format used for drvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
drvstart

The timestamp to start enumerating from. Ignored when processing a list of revision IDs.

Type: timestamp (allowed formats)
drvend

The timestamp to stop enumerating at. Ignored when processing a list of revision IDs.

Type: timestamp (allowed formats)
drvdir

In which direction to enumerate:

newer
List oldest first. Note: drvstart has to be before drvend.
older
List newest first (default). Note: drvstart has to be later than drvend.
One of the following values: newer, older
Default: older
drvtag

Only list revisions tagged with this tag.

drvuser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drvexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=description (desc)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get a short description a.k.a. subtitle explaining what the target page is about.

The description is plain text, on a single line, but otherwise arbitrary (potentially including raw HTML tags, which also should be interpreted as plain text). It must not be used in HTML unescaped!

Specific parameters:
Other general parameters are available.
desccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0
descprefersource

Which description source to prefer if present:

local
Local descriptions via {{SHORTDESC:...}} parser function in the wikitext of the page.
central
Central descriptions from the associated Wikidata item.
One of the following values: central, local
Default: local
Examples:
Get the description for the page 'London'.
api.php?action=query&prop=description&titles=London [open in sandbox]
Get the description for the page 'London', preferring the central description if it exists.
api.php?action=query&prop=description&titles=London&descprefersource=central [open in sandbox]

prop=duplicatefiles (df)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all files that are duplicates of the given files based on hash values.

Specific parameters:
Other general parameters are available.
dflimit

How many duplicate files to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
dfcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

dfdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
dflocalonly

Look only for files in the local repository.

Type: boolean (details)

Returns all external URLs (not interwikis) from the given pages.

Specific parameters:
Other general parameters are available.
ellimit

How many links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
elcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

elprotocol

Protocol of the URL. If empty and elquery is set, the protocol is http and https. Leave both this and elquery empty to list all external links.

One of the following values: Can be empty, or bitcoin, commonsfinder, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
Default: (empty)
elquery

Search string without protocol. Useful for checking whether a certain page contains a certain external url.

elexpandurl
Deprecated.

Expand protocol-relative URLs with the canonical protocol.

Type: boolean (details)

prop=extracts (ex)

Returns plain-text or limited HTML extracts of the given pages.

Specific parameters:
Other general parameters are available.
exchars

How many characters to return. Actual text returned might be slightly longer.

Type: integer
The value must be between 1 and 1,200.
exsentences

How many sentences to return.

Type: integer
The value must be between 1 and 10.
exlimit

How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)

Type: integer or max
The value must be between 1 and 20.
Default: 20
exintro

Return only content before the first section.

Type: boolean (details)
explaintext

Return extracts as plain text instead of limited HTML.

Type: boolean (details)
exsectionformat

How to format sections in plaintext mode:

plain
No formatting.
wiki
Wikitext-style formatting (== like this ==).
raw
This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
One of the following values: plain, raw, wiki
Default: wiki
excontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer

prop=fileusage (fu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that use the given files.

Specific parameters:
Other general parameters are available.
fuprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
funamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
fushow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
fulimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
fucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=flagged

  • This module requires read rights.
  • Source: FlaggedRevs (Pending Changes)
  • License: GPL-2.0-or-later

Get information about the flagging status of the given pages.

If a page is flagged, the following parameters are returned:

stable_revid
The revision ID of the latest stable revision.
level
level_text
The highest flagging level of the page.
pending_since
If there are any current unreviewed revisions for that page, holds the timestamp of the first of them.

If the page has protection configuration, the following parameters are returned:

protection_level
The right a user must have to not require review on the page.
protection_expiry
When the protection expires.


prop=globalusage (gu)

  • This module requires read rights.
  • Source: Global Usage
  • License: MIT

Returns global image usage for a certain image.

Specific parameters:
Other general parameters are available.
guprop

Which properties to return:

url
Adds url.
pageid
Adds page ID.
namespace
Adds namespace ID.
Values (separate with | or alternative): namespace, pageid, url
Default: url
gulimit

How many links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
gunamespace

Limit results to these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: *
gusite

Limit results to these sites.

Values (separate with | or alternative): aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, alswikibooks, alswikiquote, alswiktionary, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fixcopyrightwiki, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, labtestwiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mowiki, mowiktionary, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikimedia, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zerowiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
Maximum number of values is 50 (500 for clients that are allowed higher limits).
gucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

gufilterlocal

Filter local usage of the file.

Type: boolean (details)

prop=growthimagesuggestiondata (gisd)

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Fetch associated image suggestion data, if available

Specific parameters:
Other general parameters are available.
gisdtasktype

Task type ID (to specify whether to fetch data for top-level or section-level image recommendations)

One of the following values: image-recommendation, section-image-recommendation
Default: image-recommendation
gisdcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=imageinfo (ii)

Returns file information and upload history.

Specific parameters:
Other general parameters are available.
iiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
user
Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
userid
Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
comment
Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
thumbmime
Adds MIME type of the image thumbnail (requires url and param iiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
mediatype
Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

archivename
Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
uploadwarning
Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timestamp, uploadwarning, url, user, userid
Default: timestamp|user
iilimit

How many file revisions to return per file.

Type: integer or max
The value must be between 1 and 500.
Default: 1
iistart

Timestamp to start listing from.

Type: timestamp (allowed formats)
iiend

Timestamp to stop listing at.

Type: timestamp (allowed formats)
iiurlwidth

If iiprop=url is set, a URL to an image scaled to this width will be returned.

For performance reasons if this option is used, no more than 50 scaled images will be returned.

Type: integer
Default: -1
iiurlheight

Similar to iiurlwidth.

Type: integer
Default: -1
iimetadataversion

Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.

Default: 1
iiextmetadatalanguage

What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.

Default: en
iiextmetadatamultilang

If translations for extmetadata property are available, fetch all of them.

Type: boolean (details)
iiextmetadatafilter

If specified and non-empty, only these keys will be returned for iiprop=extmetadata.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
iiurlparam

A handler specific parameter string. For example, PDFs might use page15-100px. iiurlwidth must be used and be consistent with iiurlparam.

Default: (empty)
iibadfilecontexttitle

If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list

iicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iilocalonly

Look only for files in the local repository.

Type: boolean (details)

prop=images (im)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all files contained on the given pages.

Specific parameters:
Other general parameters are available.
imlimit

How many files to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
imcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

imimages

Only list these files. Useful for checking whether a certain page has a certain file.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
imdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

prop=info (in)

Get basic page information.

Specific parameters:
Other general parameters are available.
inprop

Which additional properties to get:

protection
List the protection level of each page.
talkid
The page ID of the talk page for each non-talk page.
watched
List the watched status of each page.
watchlistlabels
List the watchlist labels for each page.
watchers
The number of watchers, if allowed.
visitingwatchers
The number of watchers of each page who have visited recent edits to that page, if allowed.
notificationtimestamp
The watchlist notification timestamp of each page.
subjectid
The page ID of the parent page for each talk page.
associatedpage
The prefixed title of the associated subject or talk page.
url
Gives a full URL, an edit URL, and the canonical URL for each page.
readable
Deprecated. Whether the user can read this page. Use intestactions=read instead.
preload
Deprecated. Gives the text returned by EditFormPreloadText. Use preloadcontent instead, which supports other kinds of preloaded text too.
preloadcontent
Gives the content to be shown in the editor when the page does not exist or while adding a new section.
editintro
Gives the intro messages that should be shown to the user while editing this page or revision, as HTML.
displaytitle
Gives the manner in which the page title is actually displayed.
varianttitles
Gives the display title in all variants of the site content language.
linkclasses
Gives the additional CSS classes (e.g. link colors) used for links to this page if they were to appear on the page named by inlinkcontext.
Values (separate with | or alternative): associatedpage, displaytitle, editintro, linkclasses, notificationtimestamp, preloadcontent, protection, subjectid, talkid, url, varianttitles, visitingwatchers, watched, watchers, watchlistlabels, preload, readable
inlinkcontext

The context title to use when determining extra CSS classes (e.g. link colors) when inprop contains linkclasses.

Type: page title
Accepts non-existent pages.
Default: Main Page
indefaultlinkcaption

Whether to consider the links as having a default caption (caption is a suffix of link target and preceded by slash, colon or start-of-string). It can have impact on the returned link classes.

Type: boolean (details)
intestactions

Test whether the current user can perform certain actions on the page.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
intestactionsdetail

Detail level for intestactions. Use the main module's errorformat and errorlang parameters to control the format of the messages returned.

boolean
Return a boolean value for each action.
full
Return messages describing why the action is disallowed, or an empty array if it is allowed.
quick
Like full but skipping expensive checks.
One of the following values: boolean, full, quick
Default: boolean
intestactionsautocreate

Test whether performing intestactions would automatically create a temporary account.

Type: boolean (details)
inpreloadcustom

Title of a custom page to use as preloaded content.

Only used when inprop contains preloadcontent.
inpreloadparams

Parameters for the custom page being used as preloaded content.

Only used when inprop contains preloadcontent.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
inpreloadnewsection

Return preloaded content for a new section on the page, rather than a new page.

Only used when inprop contains preloadcontent.
Type: boolean (details)
ineditintrostyle

Some intro messages come with optional wrapper frames. Use moreframes to include them or lessframes to omit them.

Only used when inprop contains editintro.
One of the following values: lessframes, moreframes
Default: moreframes
ineditintroskip

List of intro messages to remove from the response. Use this if a specific message is not relevant to your tool, or if the information is conveyed in a different way.

Only used when inprop contains editintro.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ineditintrocustom

Title of a custom page to use as an additional intro message.

Only used when inprop contains editintro.
incontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=isreviewed

  • This module requires read rights.
  • Source: PageTriage
  • License: MIT

Determine if a page is marked as reviewed.


Returns all interwiki links from the given pages.

Specific parameters:
Other general parameters are available.
iwprop

Which additional properties to get for each interwiki link:

url
Adds the full URL.
Values (separate with | or alternative): url
iwprefix

Only return interwiki links with this prefix.

iwtitle

Interwiki link to search for. Must be used with iwprefix.

iwdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
iwlimit

How many interwiki links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
iwcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iwurl
Deprecated.

Whether to get the full URL (cannot be used with iwprop).

Type: boolean (details)

Returns all interlanguage links from the given pages.

Specific parameters:
Other general parameters are available.
llprop

Which additional properties to get for each interlanguage link:

url
Adds the full URL.
langname
Adds the localised language name (best effort). Use llinlanguagecode to control the language.
autonym
Adds the native language name.
Values (separate with | or alternative): autonym, langname, url
lllang

Only return language links with this language code.

lltitle

Link to search for. Must be used with lllang.

lldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
llinlanguagecode

Language code for localised language names.

Default: en
lllimit

How many langlinks to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
llcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

llurl
Deprecated.

Whether to get the full URL (cannot be used with llprop).

Type: boolean (details)

prop=langlinkscount

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get the number of other language versions.


Example:
Get the number of other language versions for 'Dog' page
api.php?action=query&prop=langlinkscount&titles=Dog&redirects=1 [open in sandbox]
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all links from the given pages.

Specific parameters:
Other general parameters are available.
plnamespace

Show links in these namespaces only.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
pllimit

How many links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
plcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

pltitles

Only list links to these titles. Useful for checking whether a certain page links to a certain title.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

prop=linkshere (lh)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given pages.

Specific parameters:
Other general parameters are available.
lhprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
lhnamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
lhshow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
lhlimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lhcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=mapdata (mpd)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Kartographer
  • License: MIT

Request all Kartographer map data for the given pages

Specific parameters:
Other general parameters are available.
mpdgroups

Pipe-separated groups to return data for

Default: (empty)
mpdlimit

Data for how many pages to return

Type: integer or max
The value must be between 1 and 500.
Default: 10
mpdcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
mpdparser

Which wikitext parser to use

parsoid
Generate HTML using Parsoid.
legacy
Generate HTML using the legacy parser.
One of the following values: legacy, parsoid
Examples:
Request all map data from the page Metallica
api.php?action=query&prop=mapdata&titles=Metallica [open in sandbox]
Request map data in groups group1 and group2 from the page Metallica
api.php?action=query&prop=mapdata&titles=Metallica&mpdgroups=group1|group2 [open in sandbox]

prop=mmcontent

Get the description and targets of a spamlist


prop=pageassessments (pa)

  • This module requires read rights.
  • Source: PageAssessments
  • License: GPL-2.0-or-later

Return associated projects and assessments for the given pages.

Specific parameters:
Other general parameters are available.
pacontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

palimit

Limit for total number of projects returned (total for all pages).

Type: integer or max
The value must be between 1 and 500.
Default: 10
pasubprojects

Also return assessments by subprojects.

Type: boolean (details)
Examples:
Get project and assessment data for pages Apple and Pear, using the newer API result format.
api.php?action=query&prop=pageassessments&titles=Apple|Pear&formatversion=2 [open in sandbox]
Get project and assessment data for page Apple.
api.php?action=query&prop=pageassessments&titles=Apple [open in sandbox]
Get project and assessment data (including for subprojects) for page Apple.
api.php?action=query&prop=pageassessments&titles=Apple&pasubprojects=true [open in sandbox]

prop=pageimages (pi)

  • This module requires read rights.
  • Source: PageImages
  • License: WTFPL

Returns information about images on the page, such as thumbnail and presence of photos.

Specific parameters:
Other general parameters are available.
piprop

Which information to return:

thumbnail
URL and dimensions of thumbnail image associated with page, if any.
name
Image title.
original
URL and original dimensions of image associated with page, if any.
Values (separate with | or alternative): name, original, thumbnail
Default: thumbnail|name
pithumbsize

Maximum width in pixels of thumbnail images.

Type: integer
Default: 50
pilimit

Properties of how many pages to return.

Type: integer or max
The value must be between 1 and 50.
Default: 50
pilicense

Limit page images to a certain license type:

free
Only free images.
any
Best image, whether free or non-free.
One of the following values: any, free
Default: free
picontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
pilangcode

Code for the language the image is going to be rendered in if multiple languages are supported

Example:
Get name and 100-pixel thumbnail of an image on the Albert Einstein page.
api.php?action=query&prop=pageimages&titles=Albert%20Einstein&pithumbsize=100 [open in sandbox]

prop=pageprops (pp)

Get various page properties defined in the page content.

Specific parameters:
Other general parameters are available.
ppcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ppprop

Only list these page properties (action=query&list=pagepropnames returns page property names in use). Useful for checking whether pages use a certain page property.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Example:
Get properties for the pages Main Page and MediaWiki.
api.php?action=query&prop=pageprops&titles=Main%20Page|MediaWiki [open in sandbox]

prop=pageterms (wbpt)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get the Wikidata terms (typically labels, descriptions and aliases) associated with a page via a sitelink.

Specific parameters:
Other general parameters are available.
wbptcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
wbptlanguage

The language code to get terms in. If not specified, the user language is used.

One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, ak, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mul, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
Default: uselang
wbptterms

The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.

Values (separate with | or alternative): alias, description, label
Default: alias|label|description
Examples:
Get all terms associated with the page 'London', in the user language.
api.php?action=query&prop=pageterms&titles=London [open in sandbox]
Get labels and aliases associated with the page 'London', in English.
api.php?action=query&prop=pageterms&titles=London&wbptterms=label|alias&wbptlanguage=en [open in sandbox]

prop=pageviews (pvip)

Shows per-page pageview data (the number of daily pageviews for each of the last pvipdays days).

The result format is page title (with underscores) => date (Ymd) => count.

Specific parameters:
Other general parameters are available.
pvipmetric

The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)

pageviews
Plain pageviews.
One of the following values: pageviews
Default: pageviews
pvipdays

The number of days to show.

Type: integer
The value must be between 1 and 60.
Default: 60
pvipcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Show pageview statistics for the main page.
api.php?action=query&titles=Main_Page&prop=pageviews [open in sandbox]

prop=redirects (rd)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all redirects to the given pages.

Specific parameters:
Other general parameters are available.
rdprop

Which properties to get:

pageid
Page ID of each redirect.
title
Title of each redirect.
fragment
Fragment of each redirect, if any.
Values (separate with | or alternative): fragment, pageid, title
Default: pageid|title
rdnamespace

Only include pages in these namespaces.

Note: Due to miser mode, using this may result in fewer than rdlimit results returned before continuing; in extreme cases, zero results may be returned.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
rdshow

Show only items that meet these criteria:

fragment
Only show redirects with a fragment.
!fragment
Only show redirects without a fragment.
Values (separate with | or alternative): !fragment, fragment
rdlimit

How many redirects to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
rdcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=revisions (rv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get revision information.

May be used in several ways:

  1. Get data about a set of pages (last revision), by setting titles or pageids.
  2. Get revisions for one given page, by using titles or pageids with start, end, or limit.
  3. Get data about a set of revisions by setting their IDs with revids.
Specific parameters:
Other general parameters are available.
rvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, rvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, rvlimit is enforced to 50.
flagged
Flagged status of the revision.
oresscores
ORES scores for the revision.
Values (separate with | or alternative): comment, content, contentmodel, flagged, flags, ids, oresscores, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
rvslots

Which revision slots to return data for, when slot-related properties are included in rvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
rvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of rvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
rvlimit

Limit how many revisions will be returned. If rvprop=content, rvprop=parsetree, rvdiffto or rvdifftotext is used, the limit is 50. If rvparse is used, the limit is 1.

May only be used with a single page (mode #2).
Type: integer or max
The value must be between 1 and 500.
rvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires rvprop=content).

Type: boolean (details)
rvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires rvprop=content).

Type: boolean (details)
rvparse
Deprecated.

Use action=parse instead. Parse revision content (requires rvprop=content). For performance reasons, if this option is used, rvlimit is enforced to 1.

Type: boolean (details)
rvsection

Only retrieve the content of the section with this identifier.

rvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, rvlimit is enforced to 50.

rvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides rvdiffto. If rvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, rvlimit is enforced to 50.

rvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with rvdifftotext.

Type: boolean (details)
rvcontentformat
Deprecated.

Serialization format used for rvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
rvstartid

Start enumeration from the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.

May only be used with a single page (mode #2).
Type: integer
rvendid

Stop enumeration at the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.

May only be used with a single page (mode #2).
Type: integer
rvstart

From which revision timestamp to start enumeration.

May only be used with a single page (mode #2).
Type: timestamp (allowed formats)
rvend

Enumerate up to this timestamp.

May only be used with a single page (mode #2).
Type: timestamp (allowed formats)
rvdir

In which direction to enumerate:

newer
List oldest first. Note: rvstart has to be before rvend.
older
List newest first (default). Note: rvstart has to be later than rvend.
May only be used with a single page (mode #2).
One of the following values: newer, older
Default: older
rvuser

Only include revisions made by user.

May only be used with a single page (mode #2).
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rvexcludeuser

Exclude revisions made by user.

May only be used with a single page (mode #2).
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rvtag

Only list revisions tagged with this tag.

rvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=stashimageinfo (sii)

Returns file information for stashed files.

Specific parameters:
Other general parameters are available.
siifilekey

Key that identifies a previous upload that was stashed temporarily.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
siisessionkey
Deprecated.

Alias for siifilekey, for backward compatibility.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
siiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
thumbmime
Adds MIME type of the image thumbnail (requires url and param siiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, commonmetadata, dimensions, extmetadata, metadata, mime, sha1, size, thumbmime, timestamp, url
Default: timestamp|url
siiurlwidth

If siiprop=url is set, a URL to an image scaled to this width will be returned.

For performance reasons if this option is used, no more than 50 scaled images will be returned.

Type: integer
Default: -1
siiurlheight

Similar to siiurlwidth.

Type: integer
Default: -1
siiurlparam

A handler specific parameter string. For example, PDFs might use page15-100px. siiurlwidth must be used and be consistent with siiurlparam.

Default: (empty)

prop=templates (tl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all pages transcluded on the given pages.

Specific parameters:
Other general parameters are available.
tlnamespace

Show templates in these namespaces only.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
tllimit

How many templates to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tlcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tltemplates

Only list these templates. Useful for checking whether a certain page uses a certain template.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
tldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
Get the templates used on the page Main Page.
api.php?action=query&prop=templates&titles=Main%20Page [open in sandbox]
Get information about the template pages used on the page Main Page.
api.php?action=query&generator=templates&titles=Main%20Page&prop=info [open in sandbox]
Get pages in the User and Template namespaces that are transcluded on the page Main Page.
api.php?action=query&prop=templates&titles=Main%20Page&tlnamespace=2|10 [open in sandbox]

prop=transcludedin (ti)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that transclude the given pages.

Specific parameters:
Other general parameters are available.
tiprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
tinamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
tishow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
tilimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ticontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=transcodestatus

  • This module requires read rights.
  • Source: TimedMediaHandler
  • License: GPL-2.0-or-later

Get transcode status for a given file page.


prop=videoinfo (vi)

  • This module requires read rights.
  • Source: TimedMediaHandler
  • License: GPL-2.0-or-later

Extends imageinfo to include video source (derivatives) information

Specific parameters:
Other general parameters are available.
viprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
user
Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
userid
Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
comment
Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
thumbmime
Adds MIME type of the image thumbnail (requires url and param viurlwidth). If the file has been revision deleted, a filehidden property will be returned.
mediatype
Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

archivename
Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
uploadwarning
Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
badfile
Adds whether the file is on the MediaWiki:Bad image list
derivatives
Adds an array of the different format and quality versions of an audio or video file that are available.
timedtext
Adds an array of the subtitles, captions and descriptions of an audio or video file that are available.
Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, derivatives, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timedtext, timestamp, uploadwarning, url, user, userid
Default: timestamp|user
vilimit

How many file revisions to return per file.

Type: integer or max
The value must be between 1 and 500.
Default: 1
vistart

Timestamp to start listing from.

Type: timestamp (allowed formats)
viend

Timestamp to stop listing at.

Type: timestamp (allowed formats)
viurlwidth

If viprop=url is set, a URL to an image scaled to this width will be returned.

For performance reasons if this option is used, no more than 50 scaled images will be returned.

Type: integer
Default: -1
viurlheight

Similar to viurlwidth.

Type: integer
Default: -1
vimetadataversion

Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.

Default: 1
viextmetadatalanguage

What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.

Default: en
viextmetadatamultilang

If translations for extmetadata property are available, fetch all of them.

Type: boolean (details)
viextmetadatafilter

If specified and non-empty, only these keys will be returned for viprop=extmetadata.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
viurlparam

A handler specific parameter string. For example, PDFs might use page15-100px. viurlwidth must be used and be consistent with viurlparam.

Default: (empty)
vibadfilecontexttitle

If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list

vicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

vilocalonly

Look only for files in the local repository.

Type: boolean (details)

prop=wbentityusage (wbeu)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Returns all entity IDs used in the given pages.

Specific parameters:
Other general parameters are available.
wbeuprop

Properties to add to the result.

url
If enabled url of entity will be added
Values (separate with | or alternative): url
wbeuaspect

Only return entity IDs that used this aspect.

S
The entity's sitelinks are used
L
The entity's label is used
D
The entity's description is used
T
The title of the local page corresponding to the entity is used
C
Statements from the entity are used
X
All aspects of an entity are or may be used
O
Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
Values (separate with | or alternative): C, D, L, O, S, T, X
wbeuentities

Only return page that used these entities.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wbeulimit

How many entity usages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wbeucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=abusefilters (abf)

Show details of the edit filters.

Specific parameters:
Other general parameters are available.
abfstartid

The filter ID to start enumerating from.

Type: integer
abfendid

The filter ID to stop enumerating at.

Type: integer
abfdir

In which direction to enumerate:

One of the following values: newer, older
Default: newer
abfshow

Show only filters which meet these criteria.

Values (separate with | or alternative): !deleted, !enabled, !private, !protected, deleted, enabled, private, protected
abflimit

The maximum number of filters to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
abfprop

Which properties to get.

Values (separate with | or alternative): actions, comments, description, hits, id, lasteditor, lastedittime, pattern, private, protected, status
Default: id|description|actions|status

list=abuselog (afl)

Show events that were caught by one of the edit filters.

Specific parameters:
Other general parameters are available.
afllogid

Show an entry with the given log ID.

Type: integer
aflstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
aflend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
afldir

In which direction to enumerate:

One of the following values: newer, older
Default: older
afluser

Show only entries done by a given user or IP address.

afltitle

Show only entries occurring on a given page.

aflfilter

Show only entries that were caught by the given filter IDs. Separate with pipes, prefix with "global-" for global filters.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
afllimit

The maximum amount of entries to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
aflprop

Which properties to get.

Values (separate with | or alternative): action, details, filter, hidden, ids, result, revid, timestamp, title, user
Default: ids|user|title|action|result|timestamp|hidden|revid

list=allcategories (ac)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all categories.

Specific parameters:
Other general parameters are available.
acfrom

The category to start enumerating from.

accontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

acto

The category to stop enumerating at.

acprefix

Search for all category titles that begin with this value.

acdir

Direction to sort in.

One of the following values: ascending, descending
Default: ascending
acmin

Only return categories with at least this many members.

Type: integer
acmax

Only return categories with at most this many members.

Type: integer
aclimit

How many categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
acprop

Which properties to get:

size
Adds number of pages in the category.
hidden
Tags categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, size
Default: (empty)
Examples:
List categories with information on the number of pages in each.
api.php?action=query&list=allcategories&acprop=size [open in sandbox]
Retrieve info about the category page itself for categories beginning List.
api.php?action=query&generator=allcategories&gacprefix=List&prop=info [open in sandbox]

list=alldeletedrevisions (adr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all deleted revisions by a user or in a namespace.

Specific parameters:
Other general parameters are available.
adrprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, adrlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, adrlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
adrslots

Which revision slots to return data for, when slot-related properties are included in adrprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
adrcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of adrslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
adrlimit

Limit how many revisions will be returned. If adrprop=content, adrprop=parsetree, adrdiffto or adrdifftotext is used, the limit is 50. If adrparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
adrexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires adrprop=content).

Type: boolean (details)
adrgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires adrprop=content).

Type: boolean (details)
adrparse
Deprecated.

Use action=parse instead. Parse revision content (requires adrprop=content). For performance reasons, if this option is used, adrlimit is enforced to 1.

Type: boolean (details)
adrsection

Only retrieve the content of the section with this identifier.

adrdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, adrlimit is enforced to 50.

adrdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides adrdiffto. If adrsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, adrlimit is enforced to 50.

adrdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with adrdifftotext.

Type: boolean (details)
adrcontentformat
Deprecated.

Serialization format used for adrdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
adruser

Only list revisions by this user.

Note: Due to miser mode, using adruser and adrnamespace together may result in fewer than adrlimit results returned before continuing; in extreme cases, zero results may be returned.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
adrnamespace

Only list pages in this namespace.

Note: Due to miser mode, using adruser and adrnamespace together may result in fewer than adrlimit results returned before continuing; in extreme cases, zero results may be returned.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
adrstart

The timestamp to start enumerating from.

May only be used with adruser.
Type: timestamp (allowed formats)
adrend

The timestamp to stop enumerating at.

May only be used with adruser.
Type: timestamp (allowed formats)
adrdir

In which direction to enumerate:

newer
List oldest first. Note: adrstart has to be before adrend.
older
List newest first (default). Note: adrstart has to be later than adrend.
One of the following values: newer, older
Default: older
adrfrom

Start listing at this title.

Cannot be used with adruser.
adrto

Stop listing at this title.

Cannot be used with adruser.
adrprefix

Search for all page titles that begin with this value.

Cannot be used with adruser.
adrexcludeuser

Don't list revisions by this user.

Cannot be used with adruser.
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
adrtag

Only list revisions tagged with this tag.

adrcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

adrgeneratetitles

When being used as a generator, generate titles rather than revision IDs.

Type: boolean (details)

list=allfileusages (af)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all file usages, including non-existing.

Specific parameters:
Other general parameters are available.
afcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

affrom

The title of the file to start enumerating from.

afto

The title of the file to stop enumerating at.

afprefix

Search for all file titles that begin with this value.

afunique

Only show distinct file titles. Cannot be used with afprop=ids.

When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
afprop

Which pieces of information to include:

ids
Adds the page IDs of the using pages (cannot be used with afunique).
title
Adds the title of the file.
Values (separate with | or alternative): ids, title
Default: title
aflimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
afdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=allimages (ai)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all images sequentially.

Specific parameters:
Other general parameters are available.
aisort

Property to sort by.

One of the following values: name, timestamp
Default: name
aidir

The direction in which to list.

One of the following values: ascending, descending, newer, older
Default: ascending
aifrom

The image title to start enumerating from. Can only be used with aisort=name.

aito

The image title to stop enumerating at. Can only be used with aisort=name.

aicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

aistart

The timestamp to start enumerating from. Can only be used with aisort=timestamp.

Type: timestamp (allowed formats)
aiend

The timestamp to end enumerating. Can only be used with aisort=timestamp.

Type: timestamp (allowed formats)
aiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
user
Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
userid
Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
comment
Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
mediatype
Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, timestamp, url, user, userid
Default: timestamp|url
aiprefix

Search for all image titles that begin with this value. Can only be used with aisort=name.

aiminsize

Limit to images with at least this many bytes.

Type: integer
aimaxsize

Limit to images with at most this many bytes.

Type: integer
aisha1

SHA1 hash of image. Overrides aisha1base36.

aisha1base36

SHA1 hash of image in base 36 (used in MediaWiki).

aiuser

Only return files where the last version was uploaded by this user. Can only be used with aisort=timestamp. Cannot be used together with aifilterbots.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
aifilterbots

How to filter files uploaded by bots. Can only be used with aisort=timestamp. Cannot be used together with aiuser.

One of the following values: all, bots, nobots
Default: all
aimime

Disabled due to miser mode.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ailimit

How many images in total to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all links that point to a given namespace.

Specific parameters:
Other general parameters are available.
alcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

alfrom

The title of the link to start enumerating from.

alto

The title of the link to stop enumerating at.

alprefix

Search for all linked titles that begin with this value.

alunique

Only show distinct linked titles. Cannot be used with alprop=ids.

When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
alprop

Which pieces of information to include:

ids
Adds the page ID of the linking page (cannot be used with alunique).
title
Adds the title of the link.
Values (separate with | or alternative): ids, title
Default: title
alnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Default: 0
allimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
aldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List linked titles, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=alllinks&alfrom=B&alprop=ids|title [open in sandbox]
List unique linked titles.
api.php?action=query&list=alllinks&alunique=&alfrom=B [open in sandbox]
Gets all linked titles, marking the missing ones.
api.php?action=query&generator=alllinks&galunique=&galfrom=B [open in sandbox]
Gets pages containing the links.
api.php?action=query&generator=alllinks&galfrom=B [open in sandbox]

list=allpages (ap)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all pages sequentially in a given namespace.

Specific parameters:
Other general parameters are available.
apfrom

The page title to start enumerating from.

apcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

apto

The page title to stop enumerating at.

apprefix

Search for all page titles that begin with this value.

apnamespace

The namespace to enumerate.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Default: 0
apfilterredir

Which pages to list.

Note: Due to miser mode, using this may result in fewer than aplimit results returned before continuing; in extreme cases, zero results may be returned.

One of the following values: all, nonredirects, redirects
Default: all
apfilterlanglinks

Filter based on whether a page has langlinks. Note that this may not consider langlinks added by extensions.

One of the following values: all, withlanglinks, withoutlanglinks
Default: all
apminsize

Limit to pages with at least this many bytes.

Type: integer
apmaxsize

Limit to pages with at most this many bytes.

Disabled due to miser mode.

Type: integer
apprtype

Limit to protected pages only.

Values (separate with | or alternative): edit, move, upload
apprlevel

Filter protections based on protection level (must be used with apprtype= parameter).

Values (separate with | or alternative): Can be empty, or autoconfirmed, extendedconfirmed, sysop, templateeditor
apprfiltercascade

Filter protections based on cascadingness (ignored when apprtype isn't set).

One of the following values: all, cascading, noncascading
Default: all
apprexpiry

Which protection expiry to filter the page on:

indefinite
Get only pages with indefinite protection expiry.
definite
Get only pages with a definite (specific) protection expiry.
all
Get pages with any protections expiry.
One of the following values: all, definite, indefinite
Default: all
aplimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
apdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=allredirects (ar)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all redirects to a namespace.

Specific parameters:
Other general parameters are available.
arcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

arfrom

The title of the redirect to start enumerating from.

arto

The title of the redirect to stop enumerating at.

arprefix

Search for all target pages that begin with this value.

arunique

Only show distinct target pages. Cannot be used with arprop=ids|fragment|interwiki.

When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
arprop

Which pieces of information to include:

ids
Adds the page ID of the redirecting page (cannot be used with arunique).
title
Adds the title of the redirect.
fragment
Adds the fragment from the redirect, if any (cannot be used with arunique).
interwiki
Adds the interwiki prefix from the redirect, if any (cannot be used with arunique).
Values (separate with | or alternative): fragment, ids, interwiki, title
Default: title
arnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Default: 0
arlimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ardir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List target pages, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=allredirects&arfrom=B&arprop=ids|title [open in sandbox]
List unique target pages.
api.php?action=query&list=allredirects&arunique=&arfrom=B [open in sandbox]
Gets all target pages, marking the missing ones.
api.php?action=query&generator=allredirects&garunique=&garfrom=B [open in sandbox]
Gets pages containing the redirects.
api.php?action=query&generator=allredirects&garfrom=B [open in sandbox]

list=allrevisions (arv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all revisions.

Specific parameters:
Other general parameters are available.
arvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, arvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, arvlimit is enforced to 50.
oresscores
ORES scores for the revision.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, oresscores, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
arvslots

Which revision slots to return data for, when slot-related properties are included in arvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
arvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of arvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
arvlimit

Limit how many revisions will be returned. If arvprop=content, arvprop=parsetree, arvdiffto or arvdifftotext is used, the limit is 50. If arvparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
arvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires arvprop=content).

Type: boolean (details)
arvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires arvprop=content).

Type: boolean (details)
arvparse
Deprecated.

Use action=parse instead. Parse revision content (requires arvprop=content). For performance reasons, if this option is used, arvlimit is enforced to 1.

Type: boolean (details)
arvsection

Only retrieve the content of the section with this identifier.

arvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, arvlimit is enforced to 50.

arvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides arvdiffto. If arvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, arvlimit is enforced to 50.

arvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with arvdifftotext.

Type: boolean (details)
arvcontentformat
Deprecated.

Serialization format used for arvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
arvuser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
arvnamespace

Only list pages in this namespace.

Note: Due to miser mode, using this may result in fewer than arvlimit results returned before continuing; in extreme cases, zero results may be returned.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
arvstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
arvend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
arvdir

In which direction to enumerate:

newer
List oldest first. Note: arvstart has to be before arvend.
older
List newest first (default). Note: arvstart has to be later than arvend.
One of the following values: newer, older
Default: older
arvexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
arvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

arvgeneratetitles

When being used as a generator, generate titles rather than revision IDs.

Type: boolean (details)

list=alltransclusions (at)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all transclusions (pages embedded using {{x}}), including non-existing.

Specific parameters:
Other general parameters are available.
atcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

atfrom

The title of the transclusion to start enumerating from.

atto

The title of the transclusion to stop enumerating at.

atprefix

Search for all transcluded titles that begin with this value.

atunique

Only show distinct transcluded titles. Cannot be used with atprop=ids.

When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
atprop

Which pieces of information to include:

ids
Adds the page ID of the transcluding page (cannot be used with atunique).
title
Adds the title of the transclusion.
Values (separate with | or alternative): ids, title
Default: title
atnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Default: 10
atlimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
atdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List transcluded titles, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=alltransclusions&atfrom=B&atprop=ids|title [open in sandbox]
List unique transcluded titles.
api.php?action=query&list=alltransclusions&atunique=&atfrom=B [open in sandbox]
Gets all transcluded titles, marking the missing ones.
api.php?action=query&generator=alltransclusions&gatunique=&gatfrom=B [open in sandbox]
Gets pages containing the transclusions.
api.php?action=query&generator=alltransclusions&gatfrom=B [open in sandbox]

list=allusers (au)

Enumerate all registered users.

Specific parameters:
Other general parameters are available.
aufrom

The username to start enumerating from.

auto

The username to stop enumerating at.

auprefix

Search for all users that begin with this value.

audir

Direction to sort in.

One of the following values: ascending, descending
Default: ascending
augroup

Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
auexcludegroup

Exclude users in the given groups.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
aurights

Only include users with the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, autoreview, autoreviewrestore, badcaptcha, badoath, badoath-long, bigdelete, block, blockemail, bot, browsearchive, campaignevents-delete-registration, campaignevents-email-participants, campaignevents-enable-registration, campaignevents-generate-invitation-lists, campaignevents-organize-events, campaignevents-view-private-participants, centralauth-createlocal, centralauth-lock, centralauth-merge, centralauth-rename, centralauth-suppress, centralauth-unmerge, changeemail, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, checkuser-userinfo, collectionsaveascommunitypage, collectionsaveasuserpage, confirmemail, createaccount, createpage, createpagemainns, createpreviouslyrenamedaccount, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, disableoath, echo-create, echo-read-notifications, edit, editautopatrolprotected, editautoreviewprotected, editcontentmodel, editeditorprotected, editextendedsemiprotected, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editpatrolprotected, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, edittrustedprotected, editusercss, edituserjs, edituserjson, enrollasmentor, extendedconfirmed, flow-create-board, flow-delete, flow-edit-post, flow-hide, flow-suppress, globalblock, globalblock-exempt, globalblock-local-status, globalblock-whitelist, globalgroupmembership, globalgrouppermissions, growthexperiments-apiqueryimagesuggestiondata, growthexperimentsuserimpacthandler, growthmentordashboardupdatedata, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-ip-lookup, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, linkpurge, mailpassword, manage-all-push-subscriptions, managechangetags, managementors, markbotedits, massmessage, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, movestable, mwoauthmanageconsumer, mwoauthmanagemygrants, mwoauthproposeconsumer, mwoauthsuppress, mwoauthupdateownconsumer, mwoauthviewprivate, mwoauthviewsuppressed, newsletter-create, newsletter-delete, newsletter-manage, newsletter-restore, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, pagetriage-copyvio, pagetriage-mark-action, pagetriage-tagging-action, patrol, patrolmarks, post-hcaptcha-token, protect, purge, read, recover-2fa, renameuser, renameuser-global, renderfile, renderfile-nonstandard, reportincident, reupload, reupload-own, reupload-shared, review, rollback, sboverride, securepoll-create-poll, securepoll-edit-poll, securepoll-view-voter-pii, sendemail, setmentor, siteadmin, skipcaptcha, spamblacklistlog, stablesettings, stashbasehtml, stashedit, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, templateeditor, thanks-notification, titleblacklistlog, torunblocked, transcode-reset, transcode-status, unblockself, undelete, unreviewedpages, unwatchedpages, upload, upload_by_url, urlshortcode, urlshortener-create-url, urlshortener-manage-url, urlshortener-view-log, userrights, userrights-interwiki, validate, verify-2fa, viewdeletedfile, viewmyprivateinfo, viewmywatchlist, viewsuppressed, wikimediaevents-hcaptcha-diff-logging
Maximum number of values is 50 (500 for clients that are allowed higher limits).
auprop

Which pieces of information to include:

blockinfo
Adds the information about a current block on the user.
groups
Lists groups that the user is in. This uses more server resources and may return fewer results than the limit.
implicitgroups
Lists all the groups the user is automatically in.
rights
Lists rights that the user has.
editcount
Adds the edit count of the user.
registration
Adds the timestamp of when the user registered if available (may be blank).
centralids
Adds the central IDs and attachment status for the user.
tempexpired
Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
Values (separate with | or alternative): blockinfo, centralids, editcount, groups, implicitgroups, registration, rights, tempexpired
aulimit

How many total usernames to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
auwitheditsonly

Only list users who have made edits.

Type: boolean (details)
auactiveusers

Only list users active in the last 30 days.

Type: boolean (details)
auattachedwiki

With auprop=centralids, also indicate whether the user is attached with the wiki identified by this ID.

auexcludenamed

Exclude users of named accounts.

Type: boolean (details)
auexcludetemp

Exclude users of temporary accounts.

Type: boolean (details)

list=automatictranslationdenselanguages

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Fetch the list of sitelinks for the article that corresponds to a given Wikidata ID, ordered by article size.

Specific parameters:
Other general parameters are available.
qid

The Wikidata ID.

This parameter is required.
section-titles

A boolean value indicating whether the section titles should be included in the response.

Type: boolean (details)
limit

The maximum number of sitelinks to fetch.

Type: integer
Default: 15
Examples:
Fetch the list of sitelinks for the 'Moon' article in all available languages, sorted by article size.
api.php?action=query&list=automatictranslationdenselanguages&qid=Q405&limit=15 [open in sandbox]
Fetch the list of sitelinks for the 'Moon' article, including the section titles, in all available languages, sorted by article size.
api.php?action=query&list=automatictranslationdenselanguages&qid=Q405&section-titles=true [open in sandbox]
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given page.

Specific parameters:
Other general parameters are available.
bltitle

Title to search. Cannot be used together with blpageid.

blpageid

Page ID to search. Cannot be used together with bltitle.

Type: integer
blcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

blnamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
bldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
blfilterredir

How to filter for redirects. If set to nonredirects when blredirect is enabled, this is only applied to the second level.

One of the following values: all, nonredirects, redirects
Default: all
bllimit

How many total pages to return. If blredirect is enabled, the limit applies to each level separately (which means up to 2 * bllimit results may be returned).

Type: integer or max
The value must be between 1 and 500.
Default: 10
blredirect

If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.

Type: boolean (details)

list=betafeatures (bf)

List all BetaFeatures

Specific parameter:
Other general parameters are available.
bfcounts

Whether to fetch how many users have enabled a certain preference.

Example:
Get all available beta features and show how many users have enabled them
api.php?action=query&list=betafeatures&bfcounts= [open in sandbox]

list=blocks (bk)

List all blocked users and IP addresses.

Specific parameters:
Other general parameters are available.
bkstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
bkend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
bkdir

In which direction to enumerate:

newer
List oldest first. Note: bkstart has to be before bkend.
older
List newest first (default). Note: bkstart has to be later than bkend.
One of the following values: newer, older
Default: older
bkids

List of block IDs to list (optional).

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bkusers

List of users to search for (optional).

Type: list of users, by any of username, IP, Temporary user and IP range
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bkip

Get all blocks applying to this IP address or CIDR range, including range blocks.

Cannot be used together with bkusers. CIDR ranges broader than IPv4/16 or IPv6/19 are not accepted.

bklimit

The maximum number of blocks to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
bkprop

Which properties to get:

id
Adds the ID of the block.
user
Adds the username of the blocked user.
userid
Adds the user ID of the blocked user.
by
Adds the username of the blocking user.
byid
Adds the user ID of the blocking user.
timestamp
Adds the timestamp of when the block was given.
expiry
Adds the timestamp of when the block expires.
reason
Adds the reason given for the block.
parsedreason
Adds the parsed reason given for the block.
range
Adds the range of IP addresses affected by the block.
flags
Tags the ban with (autoblock, anononly, etc.).
restrictions
Adds the partial block restrictions if the block is not sitewide.
Values (separate with | or alternative): by, byid, expiry, flags, id, parsedreason, range, reason, restrictions, timestamp, user, userid
Default: id|user|by|timestamp|expiry|reason|flags
bkshow

Show only items that meet these criteria.

For example, to see only indefinite blocks on IP addresses, set bkshow=ip|!temp.

Values (separate with | or alternative): !account, !ip, !range, !temp, account, ip, range, temp
bkcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=categorymembers (cm)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all pages in a given category.

Specific parameters:
Other general parameters are available.
cmtitle

Which category to enumerate (required). Must include the Category: prefix. Cannot be used together with cmpageid.

cmpageid

Page ID of the category to enumerate. Cannot be used together with cmtitle.

Type: integer
cmprop

Which pieces of information to include:

ids
Adds the page ID.
title
Adds the title and namespace ID of the page.
sortkey
Adds the sortkey used for sorting in the category (hexadecimal string).
sortkeyprefix
Adds the sortkey prefix used for sorting in the category (human-readable part of the sortkey).
type
Adds the type that the page has been categorised as (page, subcat or file).
timestamp
Adds the timestamp of when the page was included.
Values (separate with | or alternative): ids, sortkey, sortkeyprefix, timestamp, title, type
Default: ids|title
cmnamespace

Only include pages in these namespaces. Note that cmtype=subcat or cmtype=file may be used instead of cmnamespace=14 or 6.

Note: Due to miser mode, using this may result in fewer than cmlimit results returned before continuing; in extreme cases, zero results may be returned.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
cmtype

Which type of category members to include. Ignored when cmsort=timestamp is set.

Values (separate with | or alternative): file, page, subcat
Default: page|subcat|file
cmcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

cmlimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
cmsort

Property to sort by.

One of the following values: sortkey, timestamp
Default: sortkey
cmdir

In which direction to sort.

One of the following values: asc, ascending, desc, descending, newer, older
Default: ascending
cmstart

Timestamp to start listing from. Can only be used with cmsort=timestamp.

Type: timestamp (allowed formats)
cmend

Timestamp to end listing at. Can only be used with cmsort=timestamp.

Type: timestamp (allowed formats)
cmstarthexsortkey

Sortkey to start listing from, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.

cmendhexsortkey

Sortkey to end listing at, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.

cmstartsortkeyprefix

Sortkey prefix to start listing from. Can only be used with cmsort=sortkey. Overrides cmstarthexsortkey.

cmendsortkeyprefix

Sortkey prefix to end listing before (not at; if this value occurs it will not be included!). Can only be used with cmsort=sortkey. Overrides cmendhexsortkey.

cmstartsortkey
Deprecated.

Use cmstarthexsortkey instead.

cmendsortkey
Deprecated.

Use cmendhexsortkey instead.

list=centralnoticeactivecampaigns (cnac)

Get a list of currently active campaigns with start and end dates and associated banners.

Specific parameter:
Other general parameters are available.
cnacincludefuture

Include enabled future campaigns (as well as currently active campaigns).

Type: boolean (details)
Example:
Get a list of currently active campaigns with start and end dates and associated banners.
api.php?action=query&list=centralnoticeactivecampaigns&format=json [open in sandbox]

list=centralnoticelogs

Get a log of campaign configuration changes.

Specific parameters:
Other general parameters are available.
campaign

Campaign name (optional). Separate multiple values with a "|" (vertical bar).

user

Username (optional).

limit

Maximum rows to return (optional).

Type: integer or max
The value must be between 1 and 500.
Default: 50
offset

Offset into result set (optional).

Type: integer
Default: 0
start

Start time of range (optional).

Type: timestamp (allowed formats)
end

End time of range (optional).

Type: timestamp (allowed formats)

list=checkuser (cu)

  • This module is deprecated.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CheckUser
  • License: GPL-2.0-or-later

This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.

Specific parameters:
Other general parameters are available.
curequest

Type of CheckUser request:

userips
Get IP address of target user.
edits
Deprecated. Get actions performed by target IP address or range.
actions
Get actions performed by target IP address or range.
ipusers
Get users from target IP address or range.
This parameter is required.
One of the following values: actions, ipusers, userips, edits
cutarget

Username, IP address, or CIDR range to check.

This parameter is required.
Type: user, by any of username, IP, Temporary user and IP range
cureason

Reason to check.

This parameter is required.
Default: (empty)
culimit

Limit of rows.

Type: integer or max
The value must be between 1 and 500.
Default: 500
cutimecond

Time limit of user data (like "-2 weeks" or "2 weeks ago").

Default: -2 weeks
cuxff

Use XFF data instead of IP address.

cutoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

list=checkuserlog (cul)

Get entries from the CheckUser log.

Specific parameters:
Other general parameters are available.
culuser

Username of the CheckUser.

cultarget

Checked user, IP address, or CIDR range.

culreason

Reason given for the check.

cullimit

Limit of rows.

Type: integer or max
The value must be between 1 and 500.
Default: 10
culdir

In which direction to enumerate:

newer
List oldest first. Note: culfrom has to be before culto.
older
List newest first (default). Note: culfrom has to be later than culto.
One of the following values: newer, older
Default: older
culfrom

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
culto

The timestamp to end enumerating.

Type: timestamp (allowed formats)
culcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=codexicons

Get Codex icons

Specific parameter:
Other general parameters are available.
names

Names of icons

This parameter is required.
Values (separate with | or alternative): cdxIconAdd, cdxIconAlert, cdxIconAlignCenter, cdxIconAlignLeft, cdxIconAlignRight, cdxIconAppearance, cdxIconArrowDown, cdxIconArrowNext, cdxIconArrowPrevious, cdxIconArrowUp, cdxIconArticle, cdxIconArticleAdd, cdxIconArticleCheck, cdxIconArticleDisambiguation, cdxIconArticleNotFound, cdxIconArticleRedirect, cdxIconArticleSearch, cdxIconArticles, cdxIconArticlesSearch, cdxIconAttachment, cdxIconBell, cdxIconBellOutline, cdxIconBigger, cdxIconBlock, cdxIconBold, cdxIconBook, cdxIconBookmark, cdxIconBookmarkList, cdxIconBookmarkOutline, cdxIconBright, cdxIconBrowser, cdxIconCalendar, cdxIconCamera, cdxIconCancel, cdxIconChart, cdxIconCheck, cdxIconCheckAll, cdxIconClear, cdxIconClock, cdxIconClose, cdxIconCode, cdxIconCollapse, cdxIconConfigure, cdxIconCopy, cdxIconCut, cdxIconDatabase, cdxIconDie, cdxIconDoubleChevronEnd, cdxIconDoubleChevronStart, cdxIconDownTriangle, cdxIconDownload, cdxIconDraggable, cdxIconEdit, cdxIconEditLock, cdxIconEditUndo, cdxIconEllipsis, cdxIconError, cdxIconExitFullscreen, cdxIconExpand, cdxIconEye, cdxIconEyeClosed, cdxIconFeedback, cdxIconFlag, cdxIconFolderPlaceholder, cdxIconFullscreen, cdxIconFunction, cdxIconFunctionArgument, cdxIconFunnel, cdxIconGlobe, cdxIconHalfBright, cdxIconHalfStar, cdxIconHand, cdxIconHeart, cdxIconHelp, cdxIconHelpNotice, cdxIconHieroglyph, cdxIconHighlight, cdxIconHistory, cdxIconHome, cdxIconImage, cdxIconImageAdd, cdxIconImageBroken, cdxIconImageGallery, cdxIconImageLayoutBasic, cdxIconImageLayoutFrame, cdxIconImageLayoutFrameless, cdxIconImageLayoutThumbnail, cdxIconImageLock, cdxIconIndent, cdxIconInfo, cdxIconInfoFilled, cdxIconInstance, cdxIconItalic, cdxIconJournal, cdxIconKey, cdxIconKeyboard, cdxIconLabFlask, cdxIconLanguage, cdxIconLargerText, cdxIconLayout, cdxIconLightbulb, cdxIconLink, cdxIconLinkExternal, cdxIconLinkSecure, cdxIconListBullet, cdxIconListNumbered, cdxIconLiteral, cdxIconLock, cdxIconLogIn, cdxIconLogOut, cdxIconLogoCC, cdxIconLogoCodex, cdxIconLogoMediaWiki, cdxIconLogoMetaWiki, cdxIconLogoWikibooks, cdxIconLogoWikidata, cdxIconLogoWikifunctions, cdxIconLogoWikimedia, cdxIconLogoWikimediaCommons, cdxIconLogoWikimediaDiscovery, cdxIconLogoWikinews, cdxIconLogoWikipedia, cdxIconLogoWikiquote, cdxIconLogoWikisource, cdxIconLogoWikispecies, cdxIconLogoWikiversity, cdxIconLogoWikivoyage, cdxIconLogoWiktionary, cdxIconMap, cdxIconMapPin, cdxIconMapPinAdd, cdxIconMapTrail, cdxIconMarkup, cdxIconMathematics, cdxIconMathematicsDisplayBlock, cdxIconMathematicsDisplayDefault, cdxIconMathematicsDisplayInline, cdxIconMenu, cdxIconMerge, cdxIconMessage, cdxIconMoon, cdxIconMove, cdxIconMoveFirst, cdxIconMoveLast, cdxIconMusicalScore, cdxIconNetwork, cdxIconNetworkOff, cdxIconNewWindow, cdxIconNewline, cdxIconNewspaper, cdxIconNext, cdxIconNoWikitext, cdxIconNotBright, cdxIconNotice, cdxIconOngoingConversation, cdxIconOutdent, cdxIconOutline, cdxIconPageSettings, cdxIconPalette, cdxIconPaste, cdxIconPause, cdxIconPlay, cdxIconPower, cdxIconPrevious, cdxIconPrinter, cdxIconPushPin, cdxIconPuzzle, cdxIconQrCode, cdxIconQuotes, cdxIconRecentChanges, cdxIconRedo, cdxIconReference, cdxIconReferenceExisting, cdxIconReferences, cdxIconReload, cdxIconRestore, cdxIconRobot, cdxIconSandbox, cdxIconSearch, cdxIconSearchCaseSensitive, cdxIconSearchDiacritics, cdxIconSearchRegularExpression, cdxIconSettings, cdxIconShare, cdxIconSignature, cdxIconSmaller, cdxIconSmallerText, cdxIconSortVertical, cdxIconSpecialCharacter, cdxIconSpecialPages, cdxIconSpeechBubble, cdxIconSpeechBubbleAdd, cdxIconSpeechBubbles, cdxIconStar, cdxIconStop, cdxIconStrikethrough, cdxIconSubscript, cdxIconSubtract, cdxIconSuccess, cdxIconSuperscript, cdxIconTable, cdxIconTableAddColumnAfter, cdxIconTableAddColumnBefore, cdxIconTableAddRowAfter, cdxIconTableAddRowBefore, cdxIconTableCaption, cdxIconTableMergeCells, cdxIconTableMoveColumnAfter, cdxIconTableMoveColumnBefore, cdxIconTableMoveRowAfter, cdxIconTableMoveRowBefore, cdxIconTag, cdxIconTemplateAdd, cdxIconTextDirLTR, cdxIconTextDirRTL, cdxIconTextFlow, cdxIconTextStyle, cdxIconTextSummary, cdxIconTrash, cdxIconTray, cdxIconUnBlock, cdxIconUnFlag, cdxIconUnLink, cdxIconUnLock, cdxIconUnStar, cdxIconUnderline, cdxIconUndo, cdxIconUpTriangle, cdxIconUpdate, cdxIconUpload, cdxIconUserActive, cdxIconUserAdd, cdxIconUserAnonymous, cdxIconUserAvatar, cdxIconUserAvatarOutline, cdxIconUserBlocked, cdxIconUserContributions, cdxIconUserGroup, cdxIconUserRights, cdxIconUserTalk, cdxIconUserTemporary, cdxIconUserTemporaryLocation, cdxIconViewCompact, cdxIconViewDetails, cdxIconVisionSimulator, cdxIconVolumeDown, cdxIconVolumeOff, cdxIconVolumeUp, cdxIconWatchlist, cdxIconWikitext, cdxIconWindow, cdxIconZoomIn, cdxIconZoomOut
Maximum number of values is 50 (500 for clients that are allowed higher limits).
To specify all values, use *.

list=contenttranslation

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Query Content Translation database for translations.

Specific parameters:
Other general parameters are available.
translationid

Translation ID.

from

The source language code.

to

The target language code.

sourcetitle

The title of the source page.

sourcesectiontitle

The title of the source section (optional).

limit

The maximum number of translations to fetch.

Type: integer or max
The value must be between 1 and 500.
Default: 100
offset

Offset into result set (optional).

type

State of the translation.

One of the following values: draft, published
Default: draft
usecase

The usecase for which the translations are being fetched (optional).

One of the following values: desktop-editor-draft, translation-corpora-units, unified-dashboard

list=contenttranslationcorpora

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get the section-aligned parallel text for a given translation. See also list=cxpublishedtranslations. Dumps are provided in different formats for high volume access.

Specific parameters:
Other general parameters are available.
translationid

ID of the translation.

This parameter is required.
Type: integer
striphtml

Whether to strip all HTML tags to return plaintext.

Type: boolean (details)
types

By default you will get all three of following if available: source text, machine translation and the postedited translation by the user. This parameter allows you not return some of these types.

Values (separate with | or alternative): mt, source, user
Default: source|mt|user

list=contenttranslationfavoritesuggestions

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get user's favorite suggestions for Content Translation.

Specific parameters:
Other general parameters are available.
limit

The maximum number of translation suggestions to fetch.

Type: integer or max
The value must be between 1 and 500.
Default: 100
offset

Offset for paginated results.

Example:
Fetch the favorite suggestions for the current user
api.php?action=query&list=contenttranslationfavoritesuggestions [open in sandbox]

list=cxpublishedtranslations

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Fetch all published translations information.

Specific parameters:
Other general parameters are available.
from

The source language code.

This parameter is required.
to

The target language code.

This parameter is required.
limit

The maximum number of translations to fetch.

Type: integer or max
The value must be between 1 and 500.
Default: 500
offset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0
Example:
Fetch all published translations, translated from English to Spanish
api.php?action=query&list=cxpublishedtranslations&from=en&to=es [open in sandbox]

list=cxtranslatorstats

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Fetch the translation statistics for the given user.

Specific parameter:
Other general parameters are available.
translator

The translator's username. This parameter is optional. If not passed, the currently logged-in user will be used.

Example:
Fetch the translation statistics for the given user.
api.php?action=query&list=cxtranslatorstats&translator=TranslatorName [open in sandbox]

list=deletedrevs (dr)

  • This module is deprecated.
  • This module requires read rights.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List deleted revisions.

Operates in three modes:

  1. List deleted revisions for the given titles, sorted by timestamp.
  2. List deleted contributions for the given user, sorted by timestamp (no titles specified).
  3. List all deleted revisions in the given namespace, sorted by title and timestamp (no titles specified, druser not set).

Certain parameters only apply to some modes and are ignored in others.

Specific parameters:
Other general parameters are available.
drstart

The timestamp to start enumerating from.

Modes: 1, 2
Type: timestamp (allowed formats)
drend

The timestamp to stop enumerating at.

Modes: 1, 2
Type: timestamp (allowed formats)
drdir

In which direction to enumerate:

newer
List oldest first. Note: drstart has to be before drend.
older
List newest first (default). Note: drstart has to be later than drend.
Modes: 1, 3
One of the following values: newer, older
Default: older
drfrom

Start listing at this title.

Mode: 3
drto

Stop listing at this title.

Mode: 3
drprefix

Search for all page titles that begin with this value.

Mode: 3
drunique

List only one revision for each page.

Mode: 3
Type: boolean (details)
drnamespace

Only list pages in this namespace.

Mode: 3
One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Default: 0
drtag

Only list revisions tagged with this tag.

druser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drprop

Which properties to get:

revid
Adds the revision ID of the deleted revision.
parentid
Adds the revision ID of the previous revision to the page.
user
Adds the user who made the revision.
userid
Adds the ID of the user who made the revision.
comment
Adds the comment of the revision.
parsedcomment
Adds the parsed comment of the revision.
minor
Tags if the revision is minor.
len
Adds the length (bytes) of the revision.
sha1
Adds the SHA-1 (base 16) of the revision.
content
Adds the content of the revision. For performance reasons, if this option is used, drlimit is enforced to 50.
token
Deprecated. Gives the edit token.
tags
Tags for the revision.
Values (separate with | or alternative): comment, content, len, minor, parentid, parsedcomment, revid, sha1, tags, user, userid, token
Default: user|comment
drlimit

The maximum amount of revisions to list. If drprop=content is used, the limit is 50.

Type: integer or max
The value must be between 1 and 500.
Default: 10
drcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
List the last deleted revisions of the pages Main Page and Talk:Main Page, with content (mode 1).
api.php?action=query&list=deletedrevs&titles=Main%20Page|Talk%3AMain%20Page&drprop=user|comment|content [open in sandbox]
List the last 50 deleted contributions by Bob (mode 2).
api.php?action=query&list=deletedrevs&druser=Bob&drlimit=50 [open in sandbox]
List the first 50 deleted revisions in the main namespace (mode 3).
api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50 [open in sandbox]
List the first 50 deleted pages in the Talk namespace (mode 3).
api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50&drnamespace=1&drunique= [open in sandbox]

list=embeddedin (ei)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that embed (transclude) the given title.

Specific parameters:
Other general parameters are available.
eititle

Title to search. Cannot be used together with eipageid.

eipageid

Page ID to search. Cannot be used together with eititle.

Type: integer
eicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

einamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
eidir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
eifilterredir

How to filter for redirects.

One of the following values: all, nonredirects, redirects
Default: all
eilimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=exturlusage (eu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate pages that contain a given URL.

Specific parameters:
Other general parameters are available.
euprop

Which pieces of information to include:

ids
Adds the ID of page.
title
Adds the title and namespace ID of the page.
url
Adds the URL used in the page.
Values (separate with | or alternative): ids, title, url
Default: ids|title|url
eucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

euprotocol

Protocol of the URL. If empty and euquery is set, the protocol is http and https. Leave both this and euquery empty to list all external links.

One of the following values: Can be empty, or bitcoin, commonsfinder, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
Default: (empty)
euquery

Search string without protocol. See Special:LinkSearch. Leave empty to list all external links.

eunamespace

The page namespaces to enumerate.

Note: Due to miser mode, using this may result in fewer than eulimit results returned before continuing; in extreme cases, zero results may be returned.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
eulimit

How many pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
euexpandurl
Deprecated.

Expand protocol-relative URLs with the canonical protocol.

Type: boolean (details)

list=filearchive (fa)

Enumerate all deleted files sequentially.

Specific parameters:
Other general parameters are available.
fafrom

The image title to start enumerating from.

fato

The image title to stop enumerating at.

faprefix

Search for all image titles that begin with this value.

fadir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
fasha1

SHA1 hash of image. Overrides fasha1base36.

fasha1base36

SHA1 hash of image in base 36 (used in MediaWiki).

faprop

Which image information to get:

sha1
Adds SHA-1 hash for the image.
timestamp
Adds timestamp for the uploaded version.
user
Adds user who uploaded the image version.
size
Adds the size of the image in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
description
Adds description of the image version.
parseddescription
Parse the description of the version.
mime
Adds MIME of the image.
mediatype
Adds the media type of the image.
metadata
Lists Exif metadata for the version of the image.
bitdepth
Adds the bit depth of the version.
archivename
Adds the filename of the archive version for non-latest versions.
Values (separate with | or alternative): archivename, bitdepth, description, dimensions, mediatype, metadata, mime, parseddescription, sha1, size, timestamp, user
Default: timestamp
falimit

How many images to return in total.

Type: integer or max
The value must be between 1 and 500.
Default: 10
facontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Show a list of all deleted files.
api.php?action=query&list=filearchive [open in sandbox]

list=gadgetcategories (gc)

Returns a list of gadget sections.

Specific parameters:
Other general parameters are available.
gcprop

What gadget section information to get:

name
Internal section name.
title
Section title.
members
Number of gadgets in section.
Values (separate with | or alternative): members, name, title
Default: name
gcnames

Names of sections to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

list=gadgets (ga)

Returns a list of gadgets used on this wiki.

Specific parameters:
Other general parameters are available.
gaprop

What gadget information to get:

id
Internal gadget ID.
metadata
The gadget metadata.
desc
Gadget description transformed into HTML (can be slow, use only if really needed).
Values (separate with | or alternative): desc, id, metadata
Default: id|metadata
gacategories

Gadgets from what categories to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
gaids

IDs of gadgets to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
gaallowedonly

List only gadgets allowed to current user.

Type: boolean (details)
gaenabledonly

List only gadgets enabled by current user.

Type: boolean (details)
Examples:
Get a list of gadgets along with their descriptions
api.php?action=query&list=gadgets&gaprop=id|desc [open in sandbox]
Get a list of gadgets with all possible properties
api.php?action=query&list=gadgets&gaprop=id|metadata|desc [open in sandbox]
Get a list of gadgets belonging to category "foo"
api.php?action=query&list=gadgets&gacategories=foo [open in sandbox]
Get information about gadgets "foo" and "bar"
api.php?action=query&list=gadgets&gaids=foo|bar&gaprop=id|desc|metadata [open in sandbox]
Get a list of gadgets enabled by current user
api.php?action=query&list=gadgets&gaenabledonly [open in sandbox]

list=geosearch (gs)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: GeoData
  • License: WTFPL

Returns pages having coordinates that are located in a certain area.

Specific parameters:
Other general parameters are available.
gscoord

Coordinate around which to search.

Format: Latitude and longitude separated by pipe (|).

gspage

Title of page around which to search.

gsbbox

Bounding box to search in: pipe (|) separated coordinates of top left and bottom right corners.

gsradius

Search radius in meters.

Type: integer
The value must be between 10 and 10,000.
Default: 500
gsmaxdim

Restrict search to objects no larger than this, in meters.

Type: integer
gssort

Set the sort order of returned results.

distance
Rank pages by their distance to the center.
relevance
Rank pages by their relevance according to CirrusSearch, similar to how Special:Search does it. Currently only supported on wikis that use the ElasticSearch backend, see mw:Extension:GeoData#Search backends.
One of the following values: distance, relevance
Default: distance
gslimit

Maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
gsglobe

Globe to search on. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.

One of the following values: earth, mars, moon, venus
Default: earth
gsnamespace

Namespaces to search.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: 0
gsprop

Which additional coordinate properties to return. (Properties that are always returned: lat, lon, and either primary or secondary as a boolean flag.)

type
Type of the object the coordinates point to. See mw:Special:MyLanguage/Extension:GeoData#Usage for details.
name
Name of the object.
dim
Approximate size of the object in meters.
country
ISO 3166-1 alpha-2 country code (e.g. US or RU).
region
ISO 3166-2 region code (the part of the ISO 3166-2 code after the dash; e.g. FL or MOS).
globe
Which terrestrial body the coordinates are relative to (e.g. moon or pluto). Defaults to Earth. See mw:Special:MyLanguage/Extension:GeoData#Glossary for details.
Values (separate with | or alternative): country, dim, globe, name, region, type
Default: globe
gsprimary

Which kind of coordinates to return.

primary
The location of the subject of the article. There is at most one primary coordinate per title.
secondary
The location of some object that's mentioned in the article. Any number of secondary coordinates can be associated with a title.
all
Return both primary and secondary coordinates.
One of the following values: all, primary, secondary
Default: primary
gsdebug

Whether debug information should be returned.

Type: boolean (details)
Examples:
Search around the point with coordinates 37° 47′ 13.1″ N, 122° 23′ 58.84″ W
api.php?action=query&list=geosearch&gsradius=10000&gscoord=37.786971|-122.399677 [open in sandbox]
Search in a bounding box
api.php?action=query&list=geosearch&gsbbox=37.8|-122.3|37.7|-122.4 [open in sandbox]

list=globalallusers (agu)

Enumerate all global users.

Specific parameters:
Other general parameters are available.
agufrom

The username to start enumerating from.

aguto

The username to stop enumerating at.

aguprefix

Search for all users that begin with this value.

agudir

Direction to sort in.

One of the following values: ascending, descending
Default: ascending
agugroup

Limit users to given global groups.

Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
aguexcludegroup

Exclude users in given global groups.

Values (separate with | or alternative): abusefilter-helper, abusefilter-maintainer, apihighlimits-requestor, captcha-exempt, founder, global-bot, global-deleter, global-flow-create, global-interface-editor, global-ipblock-exempt, global-rollbacker, global-sysop, global-temporary-account-viewer, local-bot, new-wikis-importer, ombuds, recursive-export, staff, steward, sysadmin, u4c-member, vrt-permissions, wmf-email-block-override, wmf-researcher
aguprop

What pieces of information to include:

lockinfo
Whether the user account is locked.
groups
Lists global groups that the user is in. This uses more server resources and may return fewer results than the limit.
existslocally
Adds the information if the user exists locally.
Values (separate with | or alternative): existslocally, groups, lockinfo
agulimit

How many total usernames to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
aguexcludenamed

Exclude users of named accounts.

Type: boolean (details)
aguexcludetemp

Exclude users of temporary accounts.

Type: boolean (details)

list=globalblocks (bg)

  • This module requires read rights.
  • Source: GlobalBlocking
  • License: GPL-2.0-or-later

List all globally blocked IP addresses.

Specific parameters:
Other general parameters are available.
bgstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
bgend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
bgdir

In which direction to enumerate:

One of the following values: newer, older
Default: older
bgids

Pipe-separated list of block IDs to list.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bgaddresses
Deprecated.

Pipe-separated list of IP addresses to search for.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bgtargets

Pipe-separated list of usernames, IP addresses, or IP ranges to search for. To search for IP blocks inside a given range, use bgip instead.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bgip

Get all blocks applying to this IP address or CIDR range, including range blocks. Cannot be used together with bgaddresses or bgtargets. CIDR ranges broader than /16 are not accepted.

bglimit

The maximum amount of blocks to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
bgprop

Which properties to get.

id
Adds the ID of the global block.
address
Deprecated. Adds the target of the global block. This is deprecated and has been replaced by the 'target' prop.
target
Adds the target of the global block.
by
Adds the username of the blocking user, along with the wiki where they performed the global block.
timestamp
Adds the timestamp of when the global block was given.
expiry
Adds the timestamp of when the global block expires.
reason
Adds the reason given for the global block.
range
Adds the range of IP addresses affected by the global block (not included if the block does not target IP addresses).
Values (separate with | or alternative): by, expiry, id, range, reason, target, timestamp, address
Default: id|target|by|timestamp|expiry|reason
Examples:
List all global blocks
api.php?action=query&list=globalblocks [open in sandbox]
List global blocks applying to IP address 192.0.2.18
api.php?action=query&list=globalblocks&bgip=192.0.2.18 [open in sandbox]

list=globalgroups (ggp)

Enumerate all global groups.

Specific parameter:
Other general parameters are available.
ggpprop

What pieces of information to include.

Values (separate with | or alternative): rights

list=globalusers (gus)

Get information about a list of global users.

Specific parameters:
Other general parameters are available.
gusprop

Which pieces of information to include:

locked
Adds information on whether the user is globally locked.
editcount
Adds the user's global edit count.
registration
Adds the user's global account registration timestamp.
localinfo
Adds the user's local account information.
groups
Lists all the global groups each user belongs to.
groupmemberships
Lists global groups that each user has been explicitly assigned to, including the expiry date of each group membership.
rights
Lists all the global rights each user has.
Values (separate with | or alternative): editcount, groupmemberships, groups, localinfo, locked, registration, rights
gususers

A list of global users to obtain information for. Cannot be used together with guscentralids.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
guscentralids

A list of central user IDs to obtain information for. Cannot be used together with gususers.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
guslocalgroups

When listing groups or rights, only include those that apply to the current wiki.

Type: boolean (details)
Examples:
Return information for the user Example.
api.php?action=query&list=globalusers&gususers=Example [open in sandbox]
Return information for the user with central ID 1.
api.php?action=query&list=globalusers&guscentralids=1 [open in sandbox]

list=growthmentorlist

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

List all the mentors


list=growthmentormentee

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Get all mentees assigned to a given mentor

Specific parameter:
Other general parameters are available.
gemmmentor

Mentor to query mentees for

This parameter is required.
Type: user, by any of username and user ID (e.g. "#12345")

list=growthstarredmentees

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Get list of mentees starred by the currently logged in mentor


list=growthtasks (gt)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Get task recommendations suitable for newcomers.

Suggests a set of articles which have some outstanding issues easy enough for a new editor to tackle.

Specific parameters:
Other general parameters are available.
gttasktypes

Task types to limit results to. Leave empty to receive all suggestions.

copyedit
Copyedit
expand
Expand short articles
links
Add links between articles
references
Find references
update
Update articles
link-recommendation
Add links between articles
revise-tone
Revise tone
Values (separate with | or alternative): copyedit, expand, link-recommendation, links, references, revise-tone, update
Default: (empty)
gttopics

Article topics to prefer in task suggestions.

architecture
Architecture
art
Art
comics-and-anime
Comics and anime
entertainment
Entertainment
fashion
Fashion
literature
Literature
music
Music
performing-arts
Performing arts
sports
Sports
tv-and-film
TV and film
video-games
Video games
biography
Biography (all)
women
Biography (women)
business-and-economics
Business and economics
education
Education
food-and-drink
Food and drink
history
History
military-and-warfare
Military and warfare
philosophy-and-religion
Philosophy and religion
politics-and-government
Politics and government
society
Society
transportation
Transportation
biology
Biology
chemistry
Chemistry
computers-and-internet
Computers and internet
earth-and-environment
Earth and environment
engineering
Engineering
general-science
General science
mathematics
Mathematics
medicine-and-health
Medicine and health
physics
Physics
technology
Technology
africa
Africa
asia
Asia
central-america
Central America
europe
Europe
north-america
North America
oceania
Oceania
south-america
South America
Values (separate with | or alternative): africa, architecture, art, asia, biography, biology, business-and-economics, central-america, chemistry, comics-and-anime, computers-and-internet, earth-and-environment, education, engineering, entertainment, europe, fashion, food-and-drink, general-science, history, literature, mathematics, medicine-and-health, military-and-warfare, music, north-america, oceania, performing-arts, philosophy-and-religion, physics, politics-and-government, society, south-america, sports, technology, transportation, tv-and-film, video-games, women
Default: (empty)
gttopicsmode

Matching mode for topics.

One of the following values: AND, OR
gtlimit

Maximum number of task suggestions to return.

Type: integer or max
The value must be between 0 and 250.
gtoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
The value must be no less than 1.
gtdebug

Add debug data to the output.

Type: boolean (details)
gtexcludepageids

Page IDs to exclude from the query.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 1,000.
Examples:
Get task recommendations for copy-editing-type tasks for the current user.
api.php?action=query&list=growthtasks&gttasktypes=copyedit [open in sandbox]
Get task recommendations for the current user, with extended information about the pages.
api.php?action=query&generator=growthtasks&ggtlimit=max&prop=info|revision [open in sandbox]

list=imageusage (iu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that use the given image title.

Specific parameters:
Other general parameters are available.
iutitle

Title to search. Cannot be used together with iupageid.

iupageid

Page ID to search. Cannot be used together with iutitle.

Type: integer
iucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iunamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
iudir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
iufilterredir

How to filter for redirects. If set to nonredirects when iuredirect is enabled, this is only applied to the second level.

One of the following values: all, nonredirects, redirects
Default: all
iulimit

How many total pages to return. If iuredirect is enabled, the limit applies to each level separately (which means up to 2 * iulimit results may be returned).

Type: integer or max
The value must be between 1 and 500.
Default: 10
iuredirect

If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.

Type: boolean (details)
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given interwiki link.

Can be used to find all links with a prefix, or all links to a title (with a given prefix). Using neither parameter is effectively "all interwiki links".

Specific parameters:
Other general parameters are available.
iwblprefix

Prefix for the interwiki.

iwbltitle

Interwiki link to search for. Must be used with iwblblprefix.

iwblcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iwbllimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
iwblprop

Which properties to get:

iwprefix
Adds the prefix of the interwiki.
iwtitle
Adds the title of the interwiki.
Values (separate with | or alternative): iwprefix, iwtitle
Default: (empty)
iwbldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given language link.

Can be used to find all links with a language code, or all links to a title (with a given language). Using neither parameter is effectively "all language links".

Note that this may not consider language links added by extensions.

Specific parameters:
Other general parameters are available.
lbllang

Language for the language link.

lbltitle

Language link to search for. Must be used with lbllang.

lblcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

lbllimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lblprop

Which properties to get:

lllang
Adds the language code of the language link.
lltitle
Adds the title of the language link.
Values (separate with | or alternative): lllang, lltitle
Default: (empty)
lbldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=linterrors (lnt)

Get a list of lint errors

Specific parameters:
Other general parameters are available.
lntcategories

Categories of lint errors

Values (separate with | or alternative): bogus-image-options, deletable-table-tag, duplicate-ids, empty-heading, fostered, fostered-transparent, html5-misnesting, large-tables, misc-tidy-replacement-issues, misnested-tag, missing-end-tag, missing-end-tag-in-heading, multi-colon-escape, multiline-html-table-in-list, multiple-unclosed-formatting-tags, night-mode-unaware-background-color, obsolete-tag, pwrap-bug-workaround, self-closed-tag, stripped-tag, template-arg-in-extension-tag, tidy-font-bug, tidy-whitespace-bug, unclosed-quotes-in-heading, wikilink-in-extlink
Default: deletable-table-tag|duplicate-ids|html5-misnesting|misc-tidy-replacement-issues|multiline-html-table-in-list|multiple-unclosed-formatting-tags|pwrap-bug-workaround|self-closed-tag|template-arg-in-extension-tag|tidy-font-bug|tidy-whitespace-bug|unclosed-quotes-in-heading|bogus-image-options|fostered|misnested-tag|multi-colon-escape|wikilink-in-extlink|empty-heading|missing-end-tag|missing-end-tag-in-heading|night-mode-unaware-background-color|obsolete-tag|stripped-tag
lntlimit

Number of results to query

Type: integer or max
The value must be between 1 and 500.
Default: 10
lntnamespace

Only include lint errors from the specified namespaces

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
lntpageid

Only include lint errors from the specified page IDs

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
lnttitle

Only include lint errors from the specified page title

lntfrom

Lint ID to start querying from

Type: integer
Example:
Get all lint errors of the obsolete-tag category
api.php?action=query&list=linterrors&lntcategories=obsolete-tag [open in sandbox]

list=logevents (le)

Get events from logs.

Specific parameters:
Other general parameters are available.
leprop

Which properties to get:

ids
Adds the ID of the log event.
title
Adds the title of the page for the log event.
type
Adds the type of log event.
user
Adds the user responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds the user ID who was responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
timestamp
Adds the timestamp for the log event.
comment
Adds the comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
details
Lists additional details about the log event. If the log event has been revision deleted, an actionhidden property will be returned.
tags
Lists tags for the log event.
Values (separate with | or alternative): comment, details, ids, parsedcomment, tags, timestamp, title, type, user, userid
Default: ids|title|type|user|timestamp|comment|details
letype

Filter log entries to only this type.

One of the following values: Can be empty, or abusefilter, abusefilter-protected-vars, abusefilterblockeddomainhit, abusefilterprivatedetails, block, checkuser-temporary-account, contentmodel, create, delete, gblblock, gblrename, gblrights, globalauth, growthexperiments, import, interwiki, ipinfo, managetags, massmessage, merge, move, newusers, oath, pagetriage-copyvio, pagetriage-curation, patrol, protect, renameuser, review, rights, spamblacklist, stable, suppress, tag, thanks, timedmediahandler, titleblacklist, upload, urlshortener, usermerge
leaction

Filter log actions to only this action. Overrides letype. In the list of possible values, values with the asterisk wildcard such as action/* can have different strings after the slash (/).

One of the following values: abusefilter-protected-vars/*, abusefilter/create, abusefilter/hit, abusefilter/modify, abusefilterblockeddomainhit/*, abusefilterprivatedetails/access, block/block, block/reblock, block/unblock, checkuser-private-event/*, checkuser-temporary-account/*, contentmodel/change, contentmodel/new, create/create, delete/delete, delete/delete_redir, delete/delete_redir2, delete/event, delete/restore, delete/revision, emailauth/*, gblblock/*, gblblock/gunblock, gblrename/merge, gblrename/promote, gblrename/rename, gblrights/deleteset, gblrights/groupperms, gblrights/groupprms2, gblrights/groupprms3, gblrights/grouprename, gblrights/newset, gblrights/setchange, gblrights/setnewtype, gblrights/setrename, gblrights/usergroups, globalauth/delete, globalauth/hide, globalauth/lock, globalauth/lockandhid, globalauth/setstatus, globalauth/unhide, globalauth/unlock, growthexperiments/addimage, growthexperiments/addlink, growthexperiments/addsectionimage, growthexperiments/claimmentee, growthexperiments/claimmentee-no-previous-mentor, growthexperiments/setmentor, growthexperiments/setmentor-no-previous-mentor, import/interwiki, import/upload, interwiki/iw_add, interwiki/iw_delete, interwiki/iw_edit, ipinfo/*, managetags/activate, managetags/create, managetags/deactivate, managetags/delete, massmessage/*, massmessage/failure, massmessage/send, massmessage/skipbadns, massmessage/skipnouser, massmessage/skipoptout, merge/merge, merge/merge-into, move/move, move/move_redir, newusers/autocreate, newusers/byemail, newusers/create, newusers/create2, newusers/forcecreatelocal, newusers/newusers, oath/*, pagetriage-copyvio/delete, pagetriage-copyvio/insert, pagetriage-curation/delete, pagetriage-curation/enqueue, pagetriage-curation/reviewed, pagetriage-curation/reviewed-article, pagetriage-curation/reviewed-redirect, pagetriage-curation/tag, pagetriage-curation/unreviewed, pagetriage-curation/unreviewed-article, pagetriage-curation/unreviewed-redirect, patrol/autopatrol, patrol/patrol, protect/modify, protect/move_prot, protect/protect, protect/unprotect, renameuser/renameuser, review/*, rights/autopromote, rights/blockautopromote, rights/erevoke, rights/restoreautopromote, rights/rights, spamblacklist/*, stable/config, stable/modify, stable/move_stable, stable/reset, suppress/block, suppress/cadelete, suppress/delete, suppress/event, suppress/hide-afl, suppress/reblock, suppress/revision, suppress/setstatus, suppress/unhide-afl, tag/update, thanks/*, timedmediahandler/resettranscode, titleblacklist/*, upload/overwrite, upload/revert, upload/upload, urlshortener/*, usermerge/*
lestart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
leend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
ledir

In which direction to enumerate:

newer
List oldest first. Note: lestart has to be before leend.
older
List newest first (default). Note: lestart has to be later than leend.
One of the following values: newer, older
Default: older
leids

Filter entries to those matching the given log ID(s).

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
leuser

Filter entries to those made by the given user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
letitle

Filter entries to those related to a page.

lenamespace

Filter entries to those in the given namespace.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
leprefix

Disabled due to miser mode.

letag

Only list event entries tagged with this tag.

lelimit

How many total event entries to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lecontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=mostviewed (pvim)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: PageViewInfo
  • License: GPL-3.0-or-later

Lists the most viewed pages (based on last day's pageview count).

Specific parameters:
Other general parameters are available.
pvimmetric

The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)

pageviews
Plain pageviews.
One of the following values: pageviews
Default: pageviews
pvimlimit

The number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
pvimoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0

list=mystashedfiles (msf)

Get a list of files in the current user's upload stash.

Specific parameters:
Other general parameters are available.
msfprop

Which properties to fetch for the files.

size
Fetch the file size and image dimensions.
type
Fetch the file's MIME type and media type.
Values (separate with | or alternative): size, type
Default: (empty)
msflimit

How many files to get.

Type: integer or max
The value must be between 1 and 500.
Default: 10
msfcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Get the filekey, file size, and pixel size of files in the current user's upload stash.
api.php?action=query&list=mystashedfiles&msfprop=size [open in sandbox]

list=oldreviewedpages (or)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: FlaggedRevs (Pending Changes)
  • License: GPL-2.0-or-later

Enumerates pages that have changes pending review.

Specific parameters:
Other general parameters are available.
orstart

Start listing at this timestamp.

Type: timestamp (allowed formats)
orend

Stop listing at this timestamp.

Type: timestamp (allowed formats)
ordir

In which direction to enumerate:

One of the following values: newer, older
Default: newer
ormaxsize

Maximum character count change size.

Type: integer
The value must be no less than 0.
orfilterwatched

How to filter for pages on your watchlist.

One of the following values: all, watched
Default: all
ornamespace

The namespaces to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: 0
orcategory

Show pages only in the given category.

orfilterredir

How to filter for redirects.

One of the following values: all, nonredirects, redirects
Default: all
orlimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=pagecollectionsmetadata

  • This module requires read rights.
  • Source: Wikimedia­Campaign­Events
  • License: GPL-2.0-or-later

Fetch page collection information for the given title.

Specific parameter:
Other general parameters are available.
titles

A string containing the page title for which the page collection information will be fetched.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Example:
Fetch the page collection information, for the collection defined inside 'TestCollection' page
api.php?action=query&list=pagecollectionsmetadata&titles=TestCollection [open in sandbox]

list=pagepropnames (ppn)

List all page property names in use on the wiki.

Specific parameters:
Other general parameters are available.
ppncontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ppnlimit

The maximum number of names to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=pageswithprop (pwp)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all pages using a given page property.

Specific parameters:
Other general parameters are available.
pwppropname

Page property for which to enumerate pages (action=query&list=pagepropnames returns page property names in use).

This parameter is required.
pwpprop

Which pieces of information to include:

ids
Adds the page ID.
title
Adds the title and namespace ID of the page.
value
Adds the value of the page property.
Values (separate with | or alternative): ids, title, value
Default: ids|title
pwpcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

pwplimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
pwpdir

In which direction to sort.

One of the following values: ascending, descending
Default: ascending

list=prefixsearch (ps)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform a prefix search for page titles.

Despite the similarity in names, this module is not intended to be equivalent to Special:PrefixIndex; for that, see action=query&list=allpages with the apprefix parameter. The purpose of this module is similar to action=opensearch: to take user input and provide the best-matching titles. Depending on the search engine backend, this might include typo correction, redirect avoidance, or other heuristics.

Specific parameters:
Other general parameters are available.
pssearch

Search string.

This parameter is required.
psnamespace

Namespaces to search. Ignored if pssearch begins with a valid namespace prefix.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: 0
pslimit

Maximum number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
psoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
The value must be no less than 0.
Default: 0
psprofile

Search profile to use.

strict
Strict profile with few punctuation characters removed but diacritics and stress marks are kept.
normal
Few punctuation characters, some diacritics and stopwords removed.
fuzzy
Similar to normal with typo correction (two typos supported).
fast-fuzzy
Experimental fuzzy profile (may be removed at any time)
classic
Classic prefix, few punctuation characters and some diacritics removed.
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: classic, engine_autoselect, fast-fuzzy, fuzzy, normal, strict
Default: engine_autoselect
Example:
Search for page titles beginning with meaning.
api.php?action=query&list=prefixsearch&pssearch=meaning [open in sandbox]

list=projectpages (wpp)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: PageAssessments
  • License: GPL-2.0-or-later

List all pages associated with one or more projects.

Specific parameters:
Other general parameters are available.
wppassessments

Also return assessments for the pages returned.

Type: boolean (details)
wppprojects

The projects to list pages for. If this parameter is omitted, all projects will be included.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wpplimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wppcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get first 10 pages associated with WikiProject Medicine or WikiProject Anatomy.
api.php?action=query&list=projectpages&wppprojects=Medicine|Anatomy [open in sandbox]
Get first 10 pages associated with WikiProject Medicine, including assessment data.
api.php?action=query&list=projectpages&wppprojects=Medicine&wppassessments=true [open in sandbox]
Get page info for first 10 pages associated with WikiProject Textile Arts.
api.php?action=query&generator=projectpages&prop=info&gwppprojects=Textile%20Arts [open in sandbox]

list=projects (pj)

  • This module requires read rights.
  • Source: PageAssessments
  • License: GPL-2.0-or-later

List all the projects.

Specific parameter:
Other general parameters are available.
pjsubprojects

Also include subprojects.

Type: boolean (details)
Examples:
Get a list of all the projects.
api.php?action=query&list=projects [open in sandbox]
Get a list of all the projects and subprojects.
api.php?action=query&list=projects&pjsubprojects=true [open in sandbox]

list=protectedtitles (pt)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all titles protected from creation.

Specific parameters:
Other general parameters are available.
ptnamespace

Only list titles in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
ptlevel

Only list titles with these protection levels.

Values (separate with | or alternative): autoconfirmed, extendedconfirmed, sysop, templateeditor
ptlimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ptdir

In which direction to enumerate:

newer
List oldest first. Note: ptstart has to be before ptend.
older
List newest first (default). Note: ptstart has to be later than ptend.
One of the following values: newer, older
Default: older
ptstart

Start listing at this protection timestamp.

Type: timestamp (allowed formats)
ptend

Stop listing at this protection timestamp.

Type: timestamp (allowed formats)
ptprop

Which properties to get:

timestamp
Adds the timestamp of when protection was added.
user
Adds the user that added the protection.
userid
Adds the user ID that added the protection.
comment
Adds the comment for the protection.
parsedcomment
Adds the parsed comment for the protection.
expiry
Adds the timestamp of when the protection will be lifted.
level
Adds the protection level.
Values (separate with | or alternative): comment, expiry, level, parsedcomment, timestamp, user, userid
Default: timestamp|level
ptcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=querypage (qp)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get a list provided by a QueryPage-based special page.

Specific parameters:
Other general parameters are available.
qppage

The name of the special page. Note, this is case-sensitive.

This parameter is required.
One of the following values: Ancientpages, BrokenRedirects, Deadendpages, DisambiguationPageLinks, DisambiguationPages, DoubleRedirects, Fewestrevisions, GadgetUsage, GloballyWantedFiles, LintTemplateErrors, ListDuplicatedFiles, Listredirects, Lonelypages, Longpages, MediaStatistics, MostGloballyLinkedFiles, Mostcategories, Mostimages, Mostinterwikis, Mostlinked, Mostlinkedcategories, Mostlinkedtemplates, Mostrevisions, OrphanedTimedText, Shortpages, Uncategorizedcategories, Uncategorizedimages, Uncategorizedpages, Uncategorizedtemplates, UnconnectedPages, Unusedcategories, Unusedimages, Unusedtemplates, Unwatchedpages, Wantedcategories, Wantedfiles, Wantedpages, Wantedtemplates, Withoutinterwiki
qpoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0
qplimit

Number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=random (rn)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get a set of random pages.

Pages are listed in a fixed sequence, only the starting point is random. This means that if, for example, Main Page is the first random page in the list, List of fictional monkeys will always be second, List of people on stamps of Vanuatu third, etc.

Specific parameters:
Other general parameters are available.
rnnamespace

Return pages in these namespaces only.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
rnfilterredir

How to filter for redirects.

One of the following values: all, nonredirects, redirects
Default: nonredirects
rnminsize

Limit to pages with at least this many bytes.

Type: integer
rnmaxsize

Limit to pages with at most this many bytes.

Type: integer
rncontentmodel

Filter pages that have the specified content model.

One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
rnredirect
Deprecated.

Use rnfilterredir=redirects instead.

Type: boolean (details)
rnlimit

Limit how many random pages will be returned.

Type: integer or max
The value must be between 1 and 500.
Default: 1
rncontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Return two random pages from the main namespace.
api.php?action=query&list=random&rnnamespace=0&rnlimit=2 [open in sandbox]
Return page info about two random pages from the main namespace.
api.php?action=query&generator=random&grnnamespace=0&grnlimit=2&prop=info [open in sandbox]
Return page info about one random page from the main namespace that has at least 500 bytes of text.
api.php?action=query&list=random&rnnamespace=0&rnlimit=1&minsize=500 [open in sandbox]

list=readinglistentries (rle)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

List the pages of a certain list.

This module has three modes of operation. With the rlelists parameter, it returns the pages in the given list(s). With the rlechangedsince parameter, it returns all list entries from any list of the current user which have been changed since the given date. (This is meant for device sync and, unlike the other modes, includes deleted entries, although not entries of deleted lists.) Without any parameters, it returns all entries from all lists of the current user.

Specific parameters:
Other general parameters are available.
rlelists

The list IDs for which to return pages. Optional. If not specified, returns entries from all lists.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 100 (500 for clients that are allowed higher limits).
rlechangedsince

Show list entries that have been changed since this timestamp. Must be after 2026-05-09T20:25:23Z.

Type: timestamp (allowed formats)
rlesort

Property to sort by. name cannot be used together with rlechangedsince. Defaults to updated when rlechangedsince is set, and to name otherwise.

name
Article title. (Project name is ignored. Sorting is by binary value; e.g. any uppercase ASCII character will sort before any lowercase one.)
updated
Last update timestamp.
One of the following values: name, updated
rledir

Sort direction: ascending (A to Z, oldest to newest) or descending.

One of the following values: ascending, descending
Default: ascending
rlelimit

Number of result items to return.

Type: integer or max
The value must be between 1 and 100.
Default: 10
rlecontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get all the pages from all reading lists of the current user.
api.php?action=query&list=readinglistentries [open in sandbox]
Get the pages from the reading lists with ID 10, 11 and 12.
api.php?action=query&list=readinglistentries&rlelists=10|11|12 [open in sandbox]
Get the list entries of the current user which have changed since 2013-01-01T00:00:00Z.
api.php?action=query&list=readinglistentries&rlechangedsince=2013-01-01T00:00:00Z [open in sandbox]

list=recentchanges (rc)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate recent changes.

Specific parameters:
Other general parameters are available.
rcstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
rcend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
rcdir

In which direction to enumerate:

newer
List oldest first. Note: rcstart has to be before rcend.
older
List newest first (default). Note: rcstart has to be later than rcend.
One of the following values: newer, older
Default: older
rcnamespace

Filter changes to only these namespaces.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
rcuser

Only list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rcexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rctag

Only list changes tagged with this tag.

rcprop

Include additional pieces of information:

user
Adds the user responsible for the edit and tags if they are an IP. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds the user ID responsible for the edit. If the user has been revision deleted, a userhidden property will be returned.
comment
Adds the comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
flags
Adds flags for the edit.
timestamp
Adds timestamp of the edit.
title
Adds the page title of the edit.
ids
Adds the page ID, recent changes ID and the new and old revision ID.
sizes
Adds the new and old page length in bytes.
redirect
Tags edit if page is a redirect.
patrolled
Tags patrollable edits as being patrolled or unpatrolled.
loginfo
Adds log information (log ID, log type, etc) to log entries.
tags
Lists tags for the entry.
sha1
Adds the content checksum for entries associated with a revision. If the content has been revision deleted, a sha1hidden property will be returned.
oresscores
Adds ORES scores for the entry.
Values (separate with | or alternative): comment, flags, ids, loginfo, oresscores, parsedcomment, patrolled, redirect, sha1, sizes, tags, timestamp, title, user, userid
Default: title|timestamp|ids
rcshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set rcshow=minor|!anon.

When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !oresreview, !patrolled, !redirect, anon, autopatrolled, bot, minor, oresreview, patrolled, redirect, unpatrolled
rclimit

How many total changes to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
rctype

Which types of changes to show.

Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
rctoponly

Only list changes which are the latest revision.

Type: boolean (details)
rctitle

Filter entries to those related to a page.

rccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

rcgeneraterevisions

When being used as a generator, generate revision IDs rather than titles. Recent change entries without associated revision IDs (e.g. most log entries) will generate nothing.

Type: boolean (details)
rcslot

Only list changes that touch the named slot.

One of the following values: main

list=search (sr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform a full text search.

Specific parameters:
Other general parameters are available.
srsearch

Search for page titles or content matching this value. You can use the search string to invoke special search features, depending on what the wiki's search backend implements.

This parameter is required.
srnamespace

Search only within these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
Default: 0
srlimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
sroffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
The value must be no less than 0.
Default: 0
srqiprofile

Query independent profile to use (affects ranking algorithm).

classic
Ranking based on the number of incoming links, some templates, page language and recency (templates/language/recency may not be activated on this wiki).
classic_noboostlinks
Ranking based on some templates, page language and recency when activated on this wiki.
empty
Ranking based solely on query dependent features (for debug only).
wsum_inclinks
Weighted sum based on incoming links
wsum_inclinks_pv
Weighted sum based on incoming links and weekly pageviews
popular_inclinks_pv
Ranking based primarily on page views
popular_inclinks
Ranking based primarily on incoming link counts
mlr-1024rs
Weighted sum based on incoming links and weekly pageviews
mlr-1024rs-next
Weighted sum based on incoming links and weekly pageviews
growth_underlinked
Internal rescore profile used in GrowthExperiments link recommendations for prioritizing articles which do not yet have enough links. This is a no-op when Link Recommendations are disabled.
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: classic, classic_noboostlinks, empty, engine_autoselect, growth_underlinked, mlr-1024rs, mlr-1024rs-next, popular_inclinks, popular_inclinks_pv, wsum_inclinks, wsum_inclinks_pv
Default: engine_autoselect
srqdprofile

Query dependent profile to use (affects ranking algorithm).

default
(no description)
perfield_builder
(no description)
perfield_builder_relaxed
(no description)
perfield_builder_title_filter
(no description)
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: default, engine_autoselect, perfield_builder, perfield_builder_relaxed, perfield_builder_title_filter
Default: engine_autoselect
srwhat

Which type of search to perform.

One of the following values: nearmatch, text, title
srinfo

Which metadata to return.

Values (separate with | or alternative): rewrittenquery, suggestion, totalhits
Default: totalhits|suggestion|rewrittenquery
srprop

Which properties to return:

size
Adds the size of the page in bytes.
wordcount
Adds the word count of the page.
timestamp
Adds the timestamp of when the page was last edited.
snippet
Adds a snippet of the page, with query term highlighting markup.
titlesnippet
Adds the page title, with query term highlighting markup.
redirecttitle
Adds the title of the matching redirect.
redirectsnippet
Adds the title of the matching redirect, with query term highlighting markup.
sectiontitle
Adds the title of the matching section.
sectionsnippet
Adds the title of the matching section, with query term highlighting markup.
isfilematch
Adds a boolean indicating if the search matched file content.
categorysnippet
Adds the matching category name, with query term highlighting markup.
score
Deprecated. Ignored.
hasrelated
Deprecated. Ignored.
extensiondata
Adds extra data generated by extensions.
Values (separate with | or alternative): categorysnippet, extensiondata, isfilematch, redirectsnippet, redirecttitle, sectionsnippet, sectiontitle, size, snippet, timestamp, titlesnippet, wordcount, hasrelated, score
Default: size|wordcount|timestamp|snippet
srinterwiki

Include interwiki results in the search, if available.

Type: boolean (details)
srenablerewrites

Enable internal query rewriting. Some search backends can rewrite the query into another which is thought to provide better results, for instance by correcting spelling errors.

Type: boolean (details)
srsort

Set the sort order of returned results.

One of the following values: create_timestamp_asc, create_timestamp_desc, incoming_links_asc, incoming_links_desc, just_match, last_edit_asc, last_edit_desc, none, random, relevance, title_natural_asc, title_natural_desc, user_random
Default: relevance

list=tags (tg)

List change tags.

Specific parameters:
Other general parameters are available.
tgcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tglimit

The maximum number of tags to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tgprop

Which properties to get:

displayname
Adds the displayed name of the tag. This property will be omitted for hidden tags.
description
Adds the description of the tag.
hitcount
Adds the number of revisions and log entries that have this tag.
defined
Indicate whether the tag is defined (see source).
source
Gets the sources of the tag definition, which may include software for software-defined tags and manual for tags that may be applied manually by users.
active
Whether the tag is still being applied by the software, or may still be applied by users.
Values (separate with | or alternative): active, defined, description, displayname, hitcount, source
Default: (empty)

list=trackingcategories (tc)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.

Specific parameters:
Other general parameters are available.
tccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tctrackingcatname

Search for all existing tracking category titles that match the provided tracking category name (as defined by "message name" on Special:TrackingCategories.)

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
tcmin

Only return existing tracking categories with at least this many members.

Type: integer
tcmax

Only return existing tracking categories with at most this many members.

Type: integer
tclimit

How many tracking categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tcprop

Which properties to get:

size
Adds number of pages in the tracking category.
hidden
Tags tracking categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, size
Default: (empty)
Examples:
List tracking categories with information on the number of pages in each.
api.php?action=query&list=trackingcategories&tcprop=size [open in sandbox]
Retrieve info about the tracking category pages representing the broken-file-category themselves, if they exist
api.php?action=query&generator=trackingcategories&gtctrackingcatname=broken-file-category&prop=info [open in sandbox]

list=usercontribs (uc)

Get all edits by a user.

Specific parameters:
Other general parameters are available.
uclimit

The maximum number of contributions to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ucstart

The start timestamp to return from, i.e. revisions before this timestamp.

Type: timestamp (allowed formats)
ucend

The end timestamp to return to, i.e. revisions after this timestamp.

Type: timestamp (allowed formats)
uccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ucuser

The users to retrieve contributions for. Cannot be used with ucuserids, ucuserprefix, or uciprange.

Type: list of users, by any of username, IP, Temporary user and interwiki name (e.g. "prefix>ExampleName")
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ucuserids

The user IDs to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or uciprange.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ucuserprefix

Retrieve contributions for all users whose names begin with this value. Cannot be used with ucuser, ucuserids, or uciprange.

uciprange

The CIDR range to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or ucuserids.

ucdir

In which direction to enumerate:

newer
List oldest first. Note: ucstart has to be before ucend.
older
List newest first (default). Note: ucstart has to be later than ucend.
One of the following values: newer, older
Default: older
ucnamespace

Only list contributions in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
ucprop

Include additional pieces of information:

ids
Adds the page ID and revision ID.
title
Adds the title and namespace ID of the page.
timestamp
Adds the timestamp of the edit.
comment
Adds the comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
size
Adds the new size of the edit.
sizediff
Adds the size delta of the edit against its parent.
flags
Adds flags of the edit.
patrolled
Tags patrolled edits.
tags
Lists tags for the edit.
oresscores
Adds ORES scores for the edit.
Values (separate with | or alternative): comment, flags, ids, oresscores, parsedcomment, patrolled, size, sizediff, tags, timestamp, title
Default: ids|title|timestamp|comment|size|flags
ucshow

Show only items that meet these criteria, e.g. non minor edits only: ucshow=!minor.

If ucshow=patrolled or ucshow=!patrolled is set, revisions older than $wgRCMaxAge (2592000 seconds) won't be shown.

When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.

Values (separate with | or alternative): !autopatrolled, !minor, !new, !oresreview, !patrolled, !top, autopatrolled, minor, new, oresreview, patrolled, top
uctag

Only list revisions tagged with this tag.

uctoponly
Deprecated.

Only list changes which are the latest revision.

Type: boolean (details)
Examples:
Show contributions of user Example.
api.php?action=query&list=usercontribs&ucuser=Example [open in sandbox]
Show contributions from all IP addresses with prefix 192.0.2..
api.php?action=query&list=usercontribs&ucuserprefix=192.0.2. [open in sandbox]

list=users (us)

Get information about a list of users.

Specific parameters:
Other general parameters are available.
usprop

Which pieces of information to include:

blockinfo
Tags if the user is blocked, by whom, and for what reason.
groups
Lists all the groups each user belongs to.
groupmemberships
Lists groups that each user has been explicitly assigned to, including the expiry date of each group membership.
implicitgroups
Lists all the groups a user is automatically a member of.
rights
Lists all the rights each user has.
editcount
Adds the user's edit count.
registration
Adds the user's registration timestamp.
emailable
Tags if the user can and wants to receive email through Special:Emailuser.
gender
Tags the gender of the user. Returns "male", "female", or "unknown".
centralids
Adds the central IDs and attachment status for the user.
cancreate
Indicates whether an account for valid but unregistered usernames can be created. To check whether the current user can perform the account creation, use action=query&meta=userinfo&uiprop=cancreateaccount.
tempexpired
Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
Values (separate with | or alternative): blockinfo, cancreate, centralids, editcount, emailable, gender, groupmemberships, groups, implicitgroups, registration, rights, tempexpired
usattachedwiki

With usprop=centralids, indicate whether the user is attached with the wiki identified by this ID.

ususers

A list of users to obtain information for.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ususerids

A list of user IDs to obtain information for.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

list=watchlist (wl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get recent changes to pages in the current user's watchlist.

Specific parameters:
Other general parameters are available.
wlallrev

Include multiple revisions of the same page within given timeframe.

Type: boolean (details)
wlstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
wlend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
wlnamespace

Filter changes to only the given namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
wluser

Only list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
wlexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
wldir

In which direction to enumerate:

newer
List oldest first. Note: wlstart has to be before wlend.
older
List newest first (default). Note: wlstart has to be later than wlend.
One of the following values: newer, older
Default: older
wllimit

How many total results to return per request.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wlprop

Which additional properties to get:

ids
Adds revision IDs and page IDs.
title
Adds title of the page.
flags
Adds flags for the edit.
user
Adds the user who made the edit. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds user ID of whoever made the edit. If the user has been revision deleted, a userhidden property will be returned.
comment
Adds comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
timestamp
Adds timestamp of the edit.
patrol
Tags edits that are patrolled.
sizes
Adds the old and new lengths of the page.
notificationtimestamp
Adds timestamp of when the user was last notified about the edit.
loginfo
Adds log information where appropriate.
tags
Lists tags for the entry.
expiry
Adds the expiry time.
labels
Adds watchlist labels associated with the entry.
oresscores
Adds ORES scores for the edit.
Values (separate with | or alternative): comment, expiry, flags, ids, labels, loginfo, notificationtimestamp, oresscores, parsedcomment, patrol, sizes, tags, timestamp, title, user, userid
Default: ids|title|flags
wlshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set wlshow=minor|!anon.

When using oresreview or !oresreview, revisions without a score (e.g. very old revisions) are considered as not needing review even if they would need review if scored.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !oresreview, !patrolled, !unread, anon, autopatrolled, bot, minor, oresreview, patrolled, unread
wltype

Which types of changes to show:

edit
Regular page edits.
new
Page creations.
log
Log entries.
external
External changes.
categorize
Category membership changes.
Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
wllabels

Only list changes with these watchlist label IDs.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wlowner

Used along with wltoken to access a different user's watchlist.

Type: user, by username
wltoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wlcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
List the top revision for recently changed pages on the current user's watchlist.
api.php?action=query&list=watchlist [open in sandbox]
Fetch additional information about the top revision for recently changed pages on the current user's watchlist.
api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment [open in sandbox]
Fetch additional information about the top revision for recently changed pages on the current user's watchlist, including when temporarily watched items will expire.
api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment|expiry [open in sandbox]
Fetch information about all recent changes to pages on the current user's watchlist.
api.php?action=query&list=watchlist&wlallrev=&wlprop=ids|title|timestamp|user|comment [open in sandbox]
Fetch page info for recently changed pages on the current user's watchlist.
api.php?action=query&generator=watchlist&prop=info [open in sandbox]
Fetch revision info for recent changes to pages on the current user's watchlist.
api.php?action=query&generator=watchlist&gwlallrev=&prop=revisions&rvprop=timestamp|user [open in sandbox]
List the top revision for recently changed pages on the watchlist of user Example.
api.php?action=query&list=watchlist&wlowner=Example&wltoken=123ABC [open in sandbox]

list=watchlistraw (wr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get all pages on the current user's watchlist.

Specific parameters:
Other general parameters are available.
wrcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

wrnamespace

Only list pages in the given namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
To specify all values, use *.
wrlimit

How many total results to return per request.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wrprop

Which additional properties to get:

changed
Adds timestamp of when the user was last notified about the edit.
Values (separate with | or alternative): changed
wrshow

Only list items that meet these criteria.

Values (separate with | or alternative): !changed, changed
wrowner

Used along with wrtoken to access a different user's watchlist.

Type: user, by username
wrtoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wrdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
wrfromtitle

Title (with namespace prefix) to begin enumerating from.

wrtotitle

Title (with namespace prefix) to stop enumerating at.

Examples:
List pages on the current user's watchlist.
api.php?action=query&list=watchlistraw [open in sandbox]
Fetch page info for pages on the current user's watchlist.
api.php?action=query&generator=watchlistraw&gwrshow=changed&prop=info [open in sandbox]

list=wblistentityusage (wbleu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Returns all pages that use the given entity IDs.

Specific parameters:
Other general parameters are available.
wbleuprop

Properties to add to the result.

url
If enabled the url of the entity will be added to the result.
Values (separate with | or alternative): url
wbleuaspect

Only return entity IDs that used this aspect.

S
The entity's sitelinks are used
L
The entity's label is used
D
The entity's description is used
T
The title of the local page corresponding to the entity is used
C
Statements from the entity are used
X
All aspects of an entity are or may be used
O
Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
Values (separate with | or alternative): C, D, L, O, S, T, X
wbleuentities

Entities that have been used.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wbleulimit

How many entity usages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wbleucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=wikisets (ws)

Enumerate all wiki sets.

Specific parameters:
Other general parameters are available.
wsfrom

The name of the wiki set to start from.

wsprop

What pieces of information to include:

type
Opt-in based (includes only specified wikis) or opt-out based (includes all wikis except specified).
wikisincluded
The wikis that are included in this wiki set.
wikisnotincluded
The wikis that are not included in this wiki set.
Values (separate with | or alternative): type, wikisincluded, wikisnotincluded
wslimit

How many wiki sets to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wsorderbyname

Order results by name.

Type: boolean (details)

meta=allmessages (am)

Return messages from this site.

Specific parameters:
Other general parameters are available.
ammessages

Which messages to output. * (default) means all messages.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: *
amprop

Which properties to get.

Values (separate with | or alternative): default
amenableparser

Set to enable parser, will preprocess the wikitext of message (substitute magic words, handle templates, etc.).

Type: boolean (details)
amnocontent

If set, do not include the content of the messages in the output.

Type: boolean (details)
amincludelocal

Also include local messages, i.e. messages that don't exist in the software but do exist as in the MediaWiki namespace.

This lists all MediaWiki-namespace pages, so it will also list those that aren't really messages such as Common.js.

Type: boolean (details)
amargs

Arguments to be substituted into message.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
amfilter

Return only messages with names that contain this string.

amcustomised

Return only messages in this customisation state.

One of the following values: all, modified, unmodified
Default: all
amlang

Return messages in this language.

amfrom

Return messages starting at this message.

amto

Return messages ending at this message.

amtitle

Page name to use as context when parsing message (for amenableparser option).

amprefix

Return messages with this prefix.

meta=authmanagerinfo (ami)

Retrieve information about the current authentication status.

Specific parameters:
Other general parameters are available.
amisecuritysensitiveoperation

Test whether the user's current authentication status is sufficient for the specified security-sensitive operation.

amirequestsfor

Fetch information about the authentication requests needed for the specified authentication action.

One of the following values: change, create, create-continue, link, link-continue, login, login-continue, remove, unlink
amireauthenticate

Add requests needed to reauthenticate for a security-sensitive operation. Must be used with amirequestsfor=login and while in a logged-in session. The value of the parameter is the operation name, which can be found in the reauthenticate error returned when trying the operation that needs reauthentication.

amimergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
amimessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
Examples:
Fetch the requests that may be used when beginning a login.
api.php?action=query&meta=authmanagerinfo&amirequestsfor=login [open in sandbox]
Fetch the requests that may be used when beginning a login, with form fields merged.
api.php?action=query&meta=authmanagerinfo&amirequestsfor=login&amimergerequestfields=1 [open in sandbox]
Test whether authentication is sufficient for action foo.
api.php?action=query&meta=authmanagerinfo&amisecuritysensitiveoperation=foo [open in sandbox]

meta=babel (bab)

Get information about what languages the user knows

Specific parameter:
Other general parameters are available.
babuser

User to get information about

This parameter is required.
Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
Example:
Get the Babel information for user Example
api.php?action=query&meta=babel&babuser=Example [open in sandbox]

meta=checkuserformattedblockinfo

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CheckUser
  • License: GPL-2.0-or-later

Return formatted block details for sitewide blocks affecting the current user.


meta=communityconfiguration (ccr)

  • This module requires read rights.
  • Source: CommunityConfiguration
  • License: GPL-3.0-or-later

Read the community configuration

Specific parameters:
Other general parameters are available.
ccrprovider

Community configuration provider ID

This parameter is required.
One of the following values: Babel, BlockedDomain, CampaignEvents, CommunityUpdates, ContentTranslation, GrowthHomepage, GrowthMentorList, GrowthSuggestedEdits, HelpPanel, Mentorship, ReportIncident, TemplateData-FeaturedTemplates
ccrassertversion

Assert specific version

meta=cxconfig

  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get ContentTranslation local configuration settings.


Example:
Get ContentTranslation local featured collection configuration.
api.php?action=query&meta=cxconfig [open in sandbox]

meta=cxdeletedtranslations (dt)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Get the number of your published translations that were deleted.

Specific parameters:
Other general parameters are available.
dtafter

Timestamp to get only newer deletions.

Type: timestamp (allowed formats)
dtnamespace

Namespace in which the deleted translations were published. Defaults to the main namespace.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 100, 101, 118, 119, 126, 127, 710, 711, 828, 829, 1728, 1729
Example:
Get the number of your deleted translations, which were published to main namespace and deleted after 2019-04-07 16:24:44
api.php?action=query&meta=cxdeletedtranslations&dtafter=2019-04-07T16%3A24%3A44.000Z&dtnamespace=0 [open in sandbox]

meta=featureusage (afu)

  • This module requires read rights.
  • Source: ApiFeatureUsage
  • License: GPL-2.0-or-later

Get a summary of logged API feature usages for a user agent.

Specific parameters:
Other general parameters are available.
afustart

Start of date range to query.

Type: timestamp (allowed formats)
afuend

End of date range to query.

Type: timestamp (allowed formats)
afuagent

User agent to query. If not specified, the agent in the request will be queried.

afufeatures

If specified, return details on only these features.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Example:
Query feature usage for the current user agent
api.php?action=query&meta=featureusage [open in sandbox]

meta=filerepoinfo (fri)

Return meta information about image repositories configured on the wiki.

Specific parameter:
Other general parameters are available.
friprop

Which repository properties to get (properties available may vary on other wikis).

canUpload
Whether files can be uploaded to this repository, e.g. via CORS and shared authentication.
descBaseUrl
(no description)
descriptionCacheExpiry
(no description)
displayname
The human-readable name of the repository wiki.
favicon
Repository wiki's favicon URL, from $wgFavicon.
fetchDescription
Whether file description pages are fetched from this repository when viewing local file description pages.
initialCapital
Whether file names implicitly start with a capital letter.
local
Whether that repository is the local one or not.
name
The key of the repository - used in e.g. $wgForeignFileRepos and imageinfo return values.
rootUrl
Root URL path for image paths.
scriptDirUrl
Root URL path for the repository wiki's MediaWiki installation.
thumbUrl
Root URL path for thumbnail paths.
url
Public zone URL path.
Values (separate with | or alternative): canUpload, descBaseUrl, descriptionCacheExpiry, displayname, favicon, fetchDescription, initialCapital, local, name, rootUrl, scriptDirUrl, thumbUrl, url
Default: canUpload|descBaseUrl|descriptionCacheExpiry|displayname|favicon|fetchDescription|initialCapital|local|name|rootUrl|scriptDirUrl|thumbUrl|url

meta=globalpreferences (gpr)

  • This module requires read rights.
  • Source: GlobalPreferences
  • License: GPL-2.0-or-later

Retrieve global preferences for the current user.

Can retrieve both global preferences and their local overrides.

Specific parameter:
Other general parameters are available.
gprprop

Which prererences to include:

preferences
Global preferences.
localoverrides
Local overrides for global preferences.
Values (separate with | or alternative): localoverrides, preferences
Default: preferences|localoverrides

meta=globalrenamestatus (grs)

Show information about global renames that are in progress.

Specific parameter:
Other general parameters are available.
grsuser

User that is being renamed. Can be either their old name or new name.

Type: user, by any of username, IP, Temporary user, IP range and interwiki name (e.g. "prefix>ExampleName")
Example:
Get information about the current global user
api.php?action=query&meta=globalrenamestatus [open in sandbox]

meta=globaluserinfo (gui)

Show information about a global user.

Specific parameters:
Other general parameters are available.
guiuser

User to get information about. If guiuser and guiid both are omitted, it defaults to the current user.

Type: user, by any of username, Temporary user and interwiki name (e.g. "prefix>ExampleName")
guiid

Global user ID to get information about. If guiuser and guiid both are omitted, it defaults to the current user.

Type: integer
guiprop

Which properties to get:

groups
Get a list of global groups this user belongs to.
rights
Get a list of global rights this user has.
merged
Get a list of merged accounts.
unattached
Get a list of unattached accounts.
editcount
Get the user's global edit count.
Values (separate with | or alternative): editcount, groups, merged, rights, unattached

meta=growthmenteestatus

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Query current user's mentee status; see documentation of action=growthsetmenteestatus for detailed information about individual statuses.


meta=growthmentorstatus

  • This module requires read rights.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Query current user's mentor status


meta=growthnextsuggestedtasktype (gnstt)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: GrowthExperiments
  • License: GPL-3.0-or-later

Get a suggested task type for a user to try next.

Specific parameter:
Other general parameters are available.
gnsttactivetasktype

The task type that the user is currently working on.

This parameter is required.
One of the following values: copyedit, expand, link-recommendation, links, references, revise-tone, update

meta=languageinfo (li)

Return information about available languages.

Continuation may be applied if retrieving the information takes too long for one request.

Specific parameters:
Other general parameters are available.
liprop

Which information to get for each language.

code
The language code. (This code is MediaWiki-specific, though there are overlaps with other standards.)
bcp47
The BCP-47 language code.
dir
The writing direction of the language (either ltr or rtl).
autonym
The autonym of the language, that is, the name in that language.
name
The name of the language in the language specified by the uselang parameter, with language fallbacks applied if necessary.
variantnames
The short names for language variants used for language conversion links.
fallbacks
The language codes of the fallback languages configured for this language. The implicit final fallback to 'en' is not included (but some languages may fall back to 'en' explicitly).
variants
The language codes of the variants supported by this language.
digittransforms
The digit transforms for formatting numbers in this language.
digitgroupingpattern
The grouping pattern for formatting numbers in this language.
minimumgroupingdigits
The number of digits below which grouping of numerals is suppressed.
namespacenames
The names of this wiki's namespaces in this language.
namespacealiases
The aliases for the namespace names in this wiki in this language.
Values (separate with | or alternative): autonym, bcp47, code, digitgroupingpattern, digittransforms, dir, fallbacks, minimumgroupingdigits, name, namespacealiases, namespacenames, variantnames, variants
Default: code
licode

Language codes of the languages that should be returned, or * for all languages.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: *
licontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get the language codes of all supported languages.
api.php?action=query&meta=languageinfo [open in sandbox]
Get the autonyms and German names of all supported languages.
api.php?action=query&meta=languageinfo&liprop=autonym|name&uselang=de [open in sandbox]
Get the fallback languages and variants of Occitan.
api.php?action=query&meta=languageinfo&liprop=fallbacks|variants&licode=oc [open in sandbox]
Get the BCP-47 language code and direction of all supported languages.
api.php?action=query&meta=languageinfo&liprop=bcp47|dir [open in sandbox]

meta=linterstats (lntrst)

Get number of lint errors in each category


Example:
Get number of lint errors in each category
api.php?action=query&meta=linterstats [open in sandbox]

meta=notifications (not)

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Get notifications waiting for the current user.

Specific parameters:
Other general parameters are available.
notwikis

List of wikis to fetch notifications from (defaults to only current wiki).

Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: enwiki
notfilter

Filter notifications returned.

Values (separate with | or alternative): !read, read
Default: read|!read
notprop

Details to request.

Values (separate with | or alternative): count, list, seenTime
Default: list
notsections

The notification sections to query (i.e. some combination of 'alert' and 'message').

Values (separate with | or alternative): alert, message
Default: alert|message
notgroupbysection

Whether to group the result by section. Each section is fetched separately if set.

Type: boolean (details)
notformat

If specified, notifications will be returned formatted this way.

model
Raw notification data
special
Formatted for Special:Notifications page (and only that!) Do not rely on the HTML as it may change at any given time.
flyout
Deprecated. Use notformat=model for raw data
html
Deprecated. Use notformat=model for raw data
One of the following values: flyout, html, model, special
notlimit

The maximum number of notifications to return.

Type: integer or max
The value must be between 1 and 50.
Default: 20
notcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

notunreadfirst

Whether to show unread notifications first (only used if groupbysection is not set).

Type: boolean (details)
nottitles

Only return notifications for these pages. To get notifications not associated with any page, use [] as a title.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
notbundle

Whether to show bundle compatible unread notifications according to notification types bundling rules.

Type: boolean (details)
notnotifiertypes

Notifier types for which to return notifications.

Values (separate with | or alternative): email, push, web
Default: web
notalertcontinue

When more alert results are available, use this to continue.

notalertunreadfirst

Whether to show unread message notifications first (only used if groupbysection is set).

Type: boolean (details)
notmessagecontinue

When more message results are available, use this to continue.

notmessageunreadfirst

Whether to show unread alert notifications first (only used if groupbysection is set).

Type: boolean (details)
notcrosswikisummary

True to opt in to a summary notification of notifications on foreign wikis.

Type: boolean (details)

meta=ores (ores)

  • This module requires read rights.
  • Source: Machine Learning Platform
  • License: GPL-3.0-or-later

Return ORES configuration and model data for this wiki.

meta=readinglists (rl)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

List or filter the user's reading lists and show metadata about them.

This module has four modes of operation. With the rllist parameter, it returns information about the specified list. With the rlchangedsince parameter, it returns all lists of the current user which have been changed since the given date. (This is meant for device sync and, unlike the other modes, includes deleted lists. Only changes to list metadata are considered, not changes to list items.) With the rlproject and rltitle parameters, it returns all lists that include that page. Without any of those parameters, it returns all lists.

Specific parameters:
Other general parameters are available.
rllist

List ID.

Type: integer
The value must be no less than 1.
rlproject

Project of the page to filter on. Must be used together with rltitle. Will only return lists which include this project and title.

rltitle

Title of the page to filter on. Must be used together with rlproject. Will only return lists which include this project and title.

rlchangedsince

Show lists that have been changed since this timestamp. Must be after 2026-05-09T20:25:24Z. Clients should use the timestamp returned in the readinglists-synctimestamp field from an earlier call if they want to ensure that no changes are missed, and should be prepared to receive changes that have already been returned in an earlier response, and handle them in an idempotent way.

Type: timestamp (allowed formats)
rlsort

Property to sort by. Ignored when rlproject and rltitle is set (results are returned in DB order). Defaults to updated when rlchangedsince is set, and to name otherwise.

name
List name. (Sorting is by binary value; e.g. any uppercase ASCII character will sort before any lowercase one.)
updated
Last update timestamp. (Updates include list metadata changes but not changes to list items.)
One of the following values: name, updated
rldir

Sort direction: ascending (A to Z, oldest to newest) or descending. Ignored when rlproject and rltitle is set.

One of the following values: ascending, descending
Default: ascending
rllimit

Number of result items to return.

Type: integer or max
The value must be between 1 and 12.
Default: 10
rlcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get the reading lists of the current user.
api.php?action=query&meta=readinglists [open in sandbox]
Get the reading lists of the current user which have changed since 2013-01-01T00:00:00Z.
api.php?action=query&meta=readinglists&rlchangedsince=2013-01-01T00:00:00Z [open in sandbox]
Get the reading lists of the current user which contain the page Dog from project en.wikipedia.org
api.php?action=query&meta=readinglists&rlproject=https%3A%2F%2Fen.wikipedia.org&rltitle=Dog [open in sandbox]

meta=siteinfo (si)

Return general information about the site.

Specific parameters:
Other general parameters are available.
siprop

Which information to get:

general
Overall system information.
namespaces
List of registered namespaces and their canonical names.
namespacealiases
List of registered namespace aliases.
specialpagealiases
List of special page aliases.
magicwords
List of magic words and their aliases.
interwikimap
Returns interwiki map (optionally filtered, optionally localised by using siinlanguagecode).
dbrepllag
Returns database server with the highest replication lag.
statistics
Returns site statistics.
usergroups
Returns user groups and the associated permissions.
autocreatetempuser
Returns configuration for the automatic creation of temporary user accounts (also known as IP masking).
clientlibraries
Returns client-side libraries installed on the wiki
libraries
Returns libraries installed on the wiki.
extensions
Returns extensions installed on the wiki.
fileextensions
Returns list of file extensions (file types) allowed to be uploaded.
rightsinfo
Returns wiki rights (license) information if available.
restrictions
Returns information on available restriction (protection) types.
languages
Returns a list of languages MediaWiki supports (optionally localised by using siinlanguagecode).
languagevariants
Returns a list of language codes for which LanguageConverter is enabled, and the variants supported for each.
skins
Returns a list of all enabled skins (optionally localised by using siinlanguagecode, otherwise in the content language).
extensiontags
Returns a list of parser extension tags.
functionhooks
Returns a list of magic word IDs for parser functions.
showhooks
Returns a list of all subscribed hooks (contents of $wgHooks).
variables
Returns a list of magic word IDs for magic variables.
doubleunderscores
Returns a list of magic word IDs for behavior switches.
protocols
Returns a list of protocols that are allowed in external links.
defaultoptions
Returns the default values for user preferences.
uploaddialog
Returns the upload dialog configuration.
autopromote
Returns the automatic promotion configuration.
autopromoteonce
Returns the automatic promotion configuration that are only done once.
copyuploaddomains
Returns the list of allowed copy upload domains
sbom
Returns a Software Bill of Materials (SBOM) for the MediaWiki installation in the CycloneDX 1.6 format.
Values (separate with | or alternative): autocreatetempuser, autopromote, autopromoteonce, clientlibraries, copyuploaddomains, dbrepllag, defaultoptions, doubleunderscores, extensions, extensiontags, fileextensions, functionhooks, general, interwikimap, languages, languagevariants, libraries, magicwords, namespacealiases, namespaces, protocols, restrictions, rightsinfo, sbom, showhooks, skins, specialpagealiases, statistics, uploaddialog, usergroups, variables
Default: general
sifilteriw

Return only local or only nonlocal entries of the interwiki map.

One of the following values: !local, local
sishowalldb

List all database servers, not just the one lagging the most.

Type: boolean (details)
sinumberingroup

Lists the number of users in user groups.

Type: boolean (details)
siinlanguagecode

Language code for localised language names (best effort) and skin names.

meta=siteviews (pvis)

Shows sitewide pageview data (daily pageview totals for each of the last pvisdays days).

The result format is date (Ymd) => count.

Specific parameters:
Other general parameters are available.
pvismetric

The metric to use for counting views. Depending on what backend is used, not all metrics might be supported. You can use the siteinfo API (action=query&meta=siteinfo) to check which ones are supported, under pageviewservice-supported-metrics / module name (siteviews, mostviewed, etc.)

pageviews
Plain pageviews.
uniques
Unique visitors.
One of the following values: pageviews, uniques
Default: pageviews
pvisdays

The number of days to show.

Type: integer
The value must be between 1 and 60.
Default: 60

meta=tokens

Gets tokens for data-modifying actions.

Specific parameter:
Other general parameters are available.
type

Types of token to request.

Values (separate with | or alternative): createaccount, csrf, deleteglobalaccount, login, patrol, rollback, setglobalaccountstatus, userrights, watch
To specify all values, use *.
Default: csrf
Examples:
Retrieve a csrf token (the default).
api.php?action=query&meta=tokens [open in sandbox]
Retrieve a watch token and a patrol token.
api.php?action=query&meta=tokens&type=watch|patrol [open in sandbox]

meta=unreadnotificationpages (unp)

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Get pages for which there are unread notifications for the current user.

Specific parameters:
Other general parameters are available.
unpwikis

List of wikis to fetch pages with unread notifications from (defaults to only current wiki).

Values (separate with | or alternative): *, aawiki, aawikibooks, aawiktionary, abstractwiki, abwiki, abwiktionary, acewiki, advisorswiki, advisorywiki, adywiki, aewikimedia, afwiki, afwikibooks, afwikiquote, afwiktionary, akwiki, akwikibooks, akwiktionary, alswiki, altwiki, amiwiki, amwiki, amwikimedia, amwikiquote, amwiktionary, angwiki, angwikibooks, angwikiquote, angwikisource, angwiktionary, annwiki, anpwiki, anwiki, anwiktionary, apiportalwiki, arbcom_cswiki, arbcom_dewiki, arbcom_enwiki, arbcom_fiwiki, arbcom_itwiki, arbcom_nlwiki, arbcom_plwiki, arbcom_ruwiki, arbcom_zhwiki, arcwiki, arwiki, arwikibooks, arwikimedia, arwikinews, arwikiquote, arwikisource, arwikiversity, arwiktionary, arywiki, arzwiki, astwiki, astwikibooks, astwikiquote, astwiktionary, aswiki, aswikibooks, aswikiquote, aswikisource, aswiktionary, atjwiki, auditcomwiki, avkwiki, avwiki, avwiktionary, awawiki, aywiki, aywikibooks, aywiktionary, azbwiki, azwiki, azwikibooks, azwikimedia, azwikiquote, azwikisource, azwiktionary, banwiki, banwikisource, barwiki, bat_smgwiki, bawiki, bawikibooks, bbcwiki, bclwiki, bclwikiquote, bclwikisource, bclwiktionary, bdrwiki, bdwikimedia, be_x_oldwiki, betawikiversity, bewiki, bewikibooks, bewikimedia, bewikiquote, bewikisource, bewiktionary, bewwiki, bewwiktionary, bgwiki, bgwikibooks, bgwikinews, bgwikiquote, bgwikisource, bgwiktionary, bhwiki, bhwiktionary, biwiki, biwikibooks, biwiktionary, bjnwiki, bjnwikiquote, bjnwiktionary, blkwiki, blkwiktionary, bmwiki, bmwikibooks, bmwikiquote, bmwiktionary, bnwiki, bnwikibooks, bnwikiquote, bnwikisource, bnwikivoyage, bnwiktionary, boardgovcomwiki, boardwiki, bowiki, bowikibooks, bowiktionary, bpywiki, brwiki, brwikimedia, brwikiquote, brwikisource, brwiktionary, bswiki, bswikibooks, bswikinews, bswikiquote, bswikisource, bswiktionary, btmwiki, btmwiktionary, bugwiki, bxrwiki, cawiki, cawikibooks, cawikimedia, cawikinews, cawikiquote, cawikisource, cawiktionary, cbk_zamwiki, cdowiki, cebwiki, cewiki, chairwiki, chapcomwiki, checkuserwiki, chowiki, chrwiki, chrwiktionary, chwiki, chwikibooks, chwiktionary, chywiki, ckbwiki, ckbwiktionary, cnwikimedia, collabwiki, commonswiki, conductwiki, cowiki, cowikibooks, cowikimedia, cowikiquote, cowiktionary, crhwiki, crwiki, crwikiquote, crwiktionary, csbwiki, csbwiktionary, cswiki, cswikibooks, cswikinews, cswikiquote, cswikisource, cswikiversity, cswikivoyage, cswiktionary, cuwiki, cvwiki, cvwikibooks, cywiki, cywikibooks, cywikiquote, cywikisource, cywiktionary, dagwiki, dawiki, dawikibooks, dawikiquote, dawikisource, dawiktionary, dewiki, dewikibooks, dewikinews, dewikiquote, dewikisource, dewikiversity, dewikivoyage, dewiktionary, dgawiki, dinwiki, diqwiki, diqwiktionary, dkwikimedia, donatewiki, dsbwiki, dtpwiki, dtywiki, dvwiki, dvwiktionary, dzwiki, dzwiktionary, ecwikimedia, eewiki, electcomwiki, elwiki, elwikibooks, elwikinews, elwikiquote, elwikisource, elwikiversity, elwikivoyage, elwiktionary, emlwiki, enwiki, enwikibooks, enwikinews, enwikiquote, enwikisource, enwikiversity, enwikivoyage, enwiktionary, eowiki, eowikibooks, eowikinews, eowikiquote, eowikisource, eowikivoyage, eowiktionary, eswiki, eswikibooks, eswikinews, eswikiquote, eswikisource, eswikiversity, eswikivoyage, eswiktionary, etwiki, etwikibooks, etwikimedia, etwikiquote, etwikisource, etwiktionary, euwiki, euwikibooks, euwikiquote, euwikisource, euwiktionary, execwiki, extwiki, fatwiki, fawiki, fawikibooks, fawikinews, fawikiquote, fawikisource, fawikivoyage, fawiktionary, fdcwiki, ffwiki, fiu_vrowiki, fiwiki, fiwikibooks, fiwikimedia, fiwikinews, fiwikiquote, fiwikisource, fiwikiversity, fiwikivoyage, fiwiktionary, fjwiki, fjwiktionary, fonwiki, foundationwiki, fowiki, fowikisource, fowiktionary, frpwiki, frrwiki, frwiki, frwikibooks, frwikinews, frwikiquote, frwikisource, frwikiversity, frwikivoyage, frwiktionary, furwiki, fywiki, fywikibooks, fywiktionary, gagwiki, ganwiki, gawiki, gawikibooks, gawikiquote, gawiktionary, gcrwiki, gdwiki, gdwiktionary, gewikimedia, glkwiki, glwiki, glwikibooks, glwikiquote, glwikisource, glwiktionary, gnwiki, gnwikibooks, gnwiktionary, gomwiki, gomwiktionary, gorwiki, gorwikiquote, gorwiktionary, gotwiki, gotwikibooks, gpewiki, grantswiki, grwikimedia, gucwiki, gurwiki, guwiki, guwikibooks, guwikiquote, guwikisource, guwiktionary, guwwiki, guwwikinews, guwwikiquote, guwwiktionary, gvwiki, gvwiktionary, hakwiki, hawiki, hawiktionary, hawwiki, hewiki, hewikibooks, hewikinews, hewikiquote, hewikisource, hewikivoyage, hewiktionary, hifwiki, hifwiktionary, hiwiki, hiwikibooks, hiwikimedia, hiwikiquote, hiwikisource, hiwikiversity, hiwikivoyage, hiwiktionary, howiki, hrwiki, hrwikibooks, hrwikiquote, hrwikisource, hrwiktionary, hsbwiki, hsbwiktionary, htwiki, htwikisource, huwiki, huwikibooks, huwikinews, huwikiquote, huwikisource, huwiktionary, hywiki, hywikibooks, hywikiquote, hywikisource, hywiktionary, hywwiki, hzwiki, iawiki, iawikibooks, iawiktionary, ibawiki, id_internalwikimedia, idwiki, idwikibooks, idwikimedia, idwikiquote, idwikisource, idwikivoyage, idwiktionary, iegcomwiki, iewiki, iewikibooks, iewiktionary, iglwiki, igwiki, igwikiquote, igwiktionary, iiwiki, ikwiki, ikwiktionary, ilowiki, ilwikimedia, incubatorwiki, inhwiki, internalwiki, iowiki, iowiktionary, iswiki, iswikibooks, iswikiquote, iswikisource, iswiktionary, itwiki, itwikibooks, itwikinews, itwikiquote, itwikisource, itwikiversity, itwikivoyage, itwiktionary, iuwiki, iuwiktionary, jamwiki, jawiki, jawikibooks, jawikinews, jawikiquote, jawikisource, jawikiversity, jawikivoyage, jawiktionary, jbowiki, jbowiktionary, jvwiki, jvwikisource, jvwiktionary, kaawiki, kaawiktionary, kabwiki, kaiwiki, kajwiki, kawiki, kawikibooks, kawikiquote, kawikisource, kawiktionary, kbdwiki, kbdwiktionary, kbpwiki, kcgwiki, kcgwiktionary, kgewiki, kgwiki, kiwiki, kjwiki, kkwiki, kkwikibooks, kkwikiquote, kkwiktionary, klwiki, klwiktionary, kmwiki, kmwikibooks, kmwiktionary, kncwiki, knwiki, knwikibooks, knwikiquote, knwikisource, knwiktionary, koiwiki, kowiki, kowikibooks, kowikinews, kowikiquote, kowikisource, kowikiversity, kowiktionary, krcwiki, krwiki, krwikiquote, kshwiki, kswiki, kswikibooks, kswikiquote, kswiktionary, kuswiki, kuwiki, kuwikibooks, kuwikiquote, kuwiktionary, kvwiki, kwwiki, kwwikiquote, kwwiktionary, kywiki, kywikibooks, kywikiquote, kywiktionary, labswiki, ladwiki, lawiki, lawikibooks, lawikiquote, lawikisource, lawiktionary, lbewiki, lbwiki, lbwikibooks, lbwikiquote, lbwiktionary, legalteamwiki, lezwiki, lfnwiki, lgwiki, lijwiki, lijwikisource, liwiki, liwikibooks, liwikinews, liwikiquote, liwikisource, liwiktionary, lldwiki, lmowiki, lmowiktionary, lnwiki, lnwikibooks, lnwiktionary, loginwiki, lowiki, lowiktionary, lrcwiki, ltgwiki, ltwiki, ltwikibooks, ltwikiquote, ltwikisource, ltwiktionary, lvwiki, lvwikibooks, lvwiktionary, madwiki, madwikisource, madwiktionary, maiwiki, maiwikimedia, map_bmswiki, mdfwiki, mediawikiwiki, metawiki, mgwiki, mgwikibooks, mgwiktionary, mhrwiki, mhwiki, mhwiktionary, minwiki, minwikibooks, minwikisource, minwiktionary, miwiki, miwikibooks, miwiktionary, mkwiki, mkwikibooks, mkwikimedia, mkwikisource, mkwiktionary, mlwiki, mlwikibooks, mlwikiquote, mlwikisource, mlwiktionary, mniwiki, mniwiktionary, mnwiki, mnwikibooks, mnwiktionary, mnwwiki, mnwwiktionary, moswiki, movementroleswiki, mrjwiki, mrwiki, mrwikibooks, mrwikiquote, mrwikisource, mrwiktionary, mswiki, mswikibooks, mswikiquote, mswikisource, mswiktionary, mtwiki, mtwiktionary, muswiki, mwlwiki, mxwikimedia, myvwiki, mywiki, mywikibooks, mywikisource, mywiktionary, mznwiki, nahwiki, nahwikibooks, nahwiktionary, napwiki, napwikisource, nawiki, nawikibooks, nawikiquote, nawiktionary, nds_nlwiki, ndswiki, ndswikibooks, ndswikiquote, ndswiktionary, newiki, newikibooks, newiktionary, newwiki, ngwiki, ngwikimedia, niawiki, niawiktionary, nlwiki, nlwikibooks, nlwikimedia, nlwikinews, nlwikiquote, nlwikisource, nlwikivoyage, nlwiktionary, nnwiki, nnwikiquote, nnwiktionary, noboard_chapterswikimedia, nostalgiawiki, novwiki, nowiki, nowikibooks, nowikimedia, nowikinews, nowikiquote, nowikisource, nowiktionary, nqowiki, nrmwiki, nrwiki, nsowiki, nupwiki, nvwiki, nycwikimedia, nywiki, nzwikimedia, ocwiki, ocwikibooks, ocwiktionary, officewiki, olowiki, ombudsmenwiki, omwiki, omwiktionary, orwiki, orwikisource, orwiktionary, oswiki, otrs_wikiwiki, outreachwiki, pa_uswikimedia, pagwiki, pamwiki, papwiki, pawiki, pawikibooks, pawikisource, pawiktionary, pcdwiki, pcmwiki, pcmwikiquote, pdcwiki, pflwiki, pihwiki, piwiki, piwiktionary, plwiki, plwikibooks, plwikimedia, plwikinews, plwikiquote, plwikisource, plwikivoyage, plwiktionary, pmswiki, pmswikisource, pnbwiki, pnbwiktionary, pntwiki, pplwiki, projectcomwiki, pswiki, pswikibooks, pswikivoyage, pswiktionary, ptwiki, ptwikibooks, ptwikimedia, ptwikinews, ptwikiquote, ptwikisource, ptwikiversity, ptwikivoyage, ptwiktionary, punjabiwikimedia, pwnwiki, qualitywiki, quwiki, quwikibooks, quwikiquote, quwiktionary, rkiwiki, rmwiki, rmwikibooks, rmwiktionary, rmywiki, rnwiki, rnwiktionary, roa_rupwiki, roa_rupwiktionary, roa_tarawiki, romdwikimedia, rowiki, rowikibooks, rowikinews, rowikiquote, rowikisource, rowikivoyage, rowiktionary, rskwiki, rswikimedia, ruewiki, ruwiki, ruwikibooks, ruwikimedia, ruwikinews, ruwikiquote, ruwikisource, ruwikiversity, ruwikivoyage, ruwiktionary, rwwiki, rwwiktionary, sahwiki, sahwikiquote, sahwikisource, satwiki, satwiktionary, sawiki, sawikibooks, sawikiquote, sawikisource, sawiktionary, scnwiki, scnwiktionary, scowiki, scwiki, scwiktionary, sdwiki, sdwikinews, sdwiktionary, searchcomwiki, sewiki, sewikibooks, sewikimedia, sgwiki, sgwiktionary, shiwiki, shnwiki, shnwikibooks, shnwikinews, shnwikivoyage, shnwiktionary, shwiki, shwiktionary, shywiktionary, simplewiki, simplewikibooks, simplewikiquote, simplewiktionary, siwiki, siwikibooks, siwiktionary, skrwiki, skrwiktionary, skwiki, skwikibooks, skwikiquote, skwikisource, skwiktionary, slwiki, slwikibooks, slwikiquote, slwikisource, slwikiversity, slwiktionary, smnwiki, smwiki, smwiktionary, snwiki, snwiktionary, sourceswiki, sowiki, sowiktionary, spcomwiki, specieswiki, sqwiki, sqwikibooks, sqwikinews, sqwikiquote, sqwiktionary, srnwiki, srwiki, srwikibooks, srwikinews, srwikiquote, srwikisource, srwiktionary, sswiki, sswiktionary, stewardwiki, stqwiki, strategywiki, stwiki, stwiktionary, suwiki, suwikibooks, suwikiquote, suwikisource, suwiktionary, svwiki, svwikibooks, svwikinews, svwikiquote, svwikisource, svwikiversity, svwikivoyage, svwiktionary, swwiki, swwikibooks, swwiktionary, sylwiki, sysop_itwiki, sysop_plwiki, szlwiki, szywiki, tawiki, tawikibooks, tawikinews, tawikiquote, tawikisource, tawiktionary, taywiki, tcywiki, tcywikisource, tcywiktionary, tddwiki, techconductwiki, tenwiki, test2wiki, testcommonswiki, testwiki, testwikidatawiki, tetwiki, tewiki, tewikibooks, tewikiquote, tewikisource, tewiktionary, tgwiki, tgwikibooks, tgwiktionary, thankyouwiki, thwiki, thwikibooks, thwikimedia, thwikinews, thwikiquote, thwikisource, thwiktionary, tigwiki, tiwiki, tiwiktionary, tkwiki, tkwikibooks, tkwikiquote, tkwiktionary, tlwiki, tlwikibooks, tlwikiquote, tlwikisource, tlwiktionary, tlywiki, tnwiki, tnwiktionary, tokwiki, towiki, towiktionary, tpiwiki, tpiwiktionary, transitionteamwiki, trvwiki, trwiki, trwikibooks, trwikimedia, trwikinews, trwikiquote, trwikisource, trwikivoyage, trwiktionary, tswiki, tswiktionary, ttwiki, ttwikibooks, ttwikiquote, ttwiktionary, tumwiki, twwiki, twwiktionary, tyvwiki, tywiki, u4cwiki, uawikimedia, udmwiki, ugwiki, ugwikibooks, ugwikiquote, ugwiktionary, ukwiki, ukwikibooks, ukwikinews, ukwikiquote, ukwikisource, ukwikivoyage, ukwiktionary, urwiki, urwikibooks, urwikiquote, urwikisource, urwiktionary, usabilitywiki, uzwiki, uzwikibooks, uzwikiquote, uzwiktionary, vecwiki, vecwikisource, vecwiktionary, vepwiki, vewiki, vewikimedia, viwiki, viwikibooks, viwikiquote, viwikisource, viwikivoyage, viwiktionary, vlswiki, votewiki, vowiki, vowikibooks, vowikiquote, vowiktionary, warwiki, wawiki, wawikibooks, wawikisource, wawiktionary, wbwikimedia, wg_enwiki, wikidatawiki, wikifunctionswiki, wikimania2005wiki, wikimania2006wiki, wikimania2007wiki, wikimania2008wiki, wikimania2009wiki, wikimania2010wiki, wikimania2011wiki, wikimania2012wiki, wikimania2013wiki, wikimania2014wiki, wikimania2015wiki, wikimania2016wiki, wikimania2017wiki, wikimania2018wiki, wikimaniateamwiki, wikimaniawiki, wowiki, wowikiquote, wowiktionary, wuuwiki, xalwiki, xhwiki, xhwikibooks, xhwiktionary, xmfwiki, yiwiki, yiwikisource, yiwiktionary, yowiki, yowikibooks, yowiktionary, yuewiktionary, zawiki, zawikibooks, zawikiquote, zawiktionary, zeawiki, zghwiki, zghwiktionary, zh_classicalwiki, zh_min_nanwiki, zh_min_nanwikibooks, zh_min_nanwikiquote, zh_min_nanwikisource, zh_min_nanwiktionary, zh_yuewiki, zhwiki, zhwikibooks, zhwikinews, zhwikiquote, zhwikisource, zhwikiversity, zhwikivoyage, zhwiktionary, zuwiki, zuwikibooks, zuwiktionary
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: enwiki
unpgrouppages

Group talk pages together with their subject page, and group notifications not associated with a page together with the current user's user page.

Type: boolean (details)
unplimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 10,000.
Default: 10
Example:
List pages with (their amount of) unread notifications
api.php?action=query&meta=unreadnotificationpages [open in sandbox]

meta=userinfo (ui)

Get information about the current user.

Specific parameters:
Other general parameters are available.
uiprop

Which pieces of information to include:

blockinfo
Tags if the current user is blocked, by whom, and for what reason.
hasmsg
Adds a tag messages if the current user has pending messages.
groups
Lists all the groups the current user belongs to.
groupmemberships
Lists groups that the current user has been explicitly assigned to, including the expiry date of each group membership.
implicitgroups
Lists all the groups the current user is automatically a member of.
rights
Lists all the rights the current user has.
changeablegroups
Lists the groups the current user can add to and remove from.
options
Lists all preferences the current user has set.
editcount
Adds the current user's edit count.
ratelimits
Lists all rate limits applying to the current user.
theoreticalratelimits
Lists all rate limits that would apply to the current user if they were not exempt from all ratelimits based on user rights or ip.
email
Adds the user's email address and email authentication date.
realname
Adds the user's real name.
acceptlang
Echoes the Accept-Language header sent by the client in a structured format.
registrationdate
Adds the user's registration date.
unreadcount
Adds the count of unread pages on the user's watchlist (maximum 999; returns 1000+ if more).
watchlistlabels
Adds watchlist labels the user has set up.
centralids
Adds the central IDs and attachment status for the user.
latestcontrib
Adds the date of user's latest contribution.
cancreateaccount
Indicates whether the user is allowed to create accounts. To check whether some specific account can be created, use action=query&list=users&usprop=cancreate.
Values (separate with | or alternative): acceptlang, blockinfo, cancreateaccount, centralids, changeablegroups, editcount, email, groupmemberships, groups, hasmsg, implicitgroups, latestcontrib, options, ratelimits, realname, registrationdate, rights, theoreticalratelimits, unreadcount, watchlistlabels
To specify all values, use *.
uiattachedwiki

With uiprop=centralids, indicate whether the user is attached with the wiki identified by this ID.

Examples:
Get information about the current user.
api.php?action=query&meta=userinfo [open in sandbox]
Get additional information about the current user.
api.php?action=query&meta=userinfo&uiprop=blockinfo|groups|rights|hasmsg [open in sandbox]

meta=wikibase (wb)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get information about the Wikibase client and the associated Wikibase repository.

Specific parameter:
Other general parameters are available.
wbprop

Which properties to get:

url
Base URL, script path and article path of the Wikibase repository.
siteid
The siteid of this site.
Values (separate with | or alternative): siteid, url
Default: url|siteid
Example:
Get URL path and other information about Wikibase client and repository.
api.php?action=query&meta=wikibase [open in sandbox]

action=readinglists

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Reading list write operations.

Create/update/delete/sort reading lists and entries. See the documentation of the various commands for details.

Specific parameters:
Other general parameters are available.
command

Command (API submodule) for reading list write operations.

create
Internal. Create a new list for the current user.
createentry
Internal. Add a new page to a list belonging to the current user.
delete
Internal. Delete a list belonging to the current user.
deleteentry
Internal. Delete a page from a list belonging to the current user.
setup
Internal. Enable lists for the current user.
teardown
Internal. Disable lists for the current user.
update
Internal. Update a list belonging to the current user.
This parameter is required.
One of the following values: create, createentry, delete, deleteentry, setup, teardown, update
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

command=create

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Create a new list for the current user.

The user must have fewer than 100 (non-deleted) lists.

Specific parameters:
Other general parameters are available.
name

List name. Required unless using batch creation.

Cannot be longer than 255 bytes.
description

List description.

Cannot be longer than 767 bytes.
batch

Batch data for creating multiple lists in a single request, in the form of a JSON array with one or more objects with name and (optionally) description fields.

command=createentry

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Add a new page to a list belonging to the current user.

List entries must be unique. Pages are not limited to the wiki where the API is accessed. The user must have fewer than 5000 (non-deleted) entries in the list.

Specific parameters:
Other general parameters are available.
list

List ID.

Type: integer
project

Project name of the wiki hosting the page. Typically this is the domain name of the wiki or @local for the local wiki. Required unless doing batch creation.

Cannot be longer than 255 bytes.
title

Page title (including the localized namespace name). Required unless doing batch creation. Human-readable format (spaces not underscores) is recommended. The API treats titles as raw strings; normalization (such as title casing) is left to the clients.

Cannot be longer than 383 bytes.
batch

Batch data for creating multiple list entries (in the same list) in a single request, in the form of a JSON array with one or more objects with project and title fields.

command=delete

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Delete a list belonging to the current user.

Deleted lists remain available for some amount of time through the readinglists and readinglistentries modules (via the changedsince parameter). There is no way to undelete.

Specific parameters:
Other general parameters are available.
list

List ID. Required unless doing batch deletion.

Type: integer
batch

Batch data for deleting multiple lists in a single request, in the form of a JSON array with one or more objects with a list field.

command=deleteentry

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Delete a page from a list belonging to the current user.

Specific parameters:
Other general parameters are available.
entry

Entry ID. Required unless doing batch deletion.

Type: integer
project

Project name of the wiki hosting the page. Must be used together with title. Deletes all entries matching the given project and title.

Cannot be longer than 255 bytes.
title

Page title to delete. Must be used together with project.

Cannot be longer than 383 bytes.
batch

Batch data for deleting multiple list entries in a single request, in the form of a JSON array with one or more objects with an entry field.

command=setup

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Enable lists for the current user.

This command must be used before the user can do anything else with reading lists. Also creates a default list. To undo it, use teardown.

Example:
Set up reading lists for the current user.
api.php?action=readinglists&command=setup&token=123ABC [open in sandbox]

command=teardown

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Disable lists for the current user.

Removes all reading list data for the user. The setup command must be used if the user wishes to begin using reading lists again.

Example:
Disable reading lists for the current user.
api.php?action=readinglists&command=teardown&token=123ABC [open in sandbox]

command=update

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ReadingLists
  • License: GPL-2.0-or-later

Update a list belonging to the current user.

Specific parameters:
Other general parameters are available.
list

List ID. Required unless using batch update.

Type: integer
name

New list name. Either this or description is required unless doing batch update.

Cannot be longer than 255 bytes.
description

New list description.

Cannot be longer than 767 bytes.
batch

Batch data for updating multiple lists in a single request, in the form of a JSON array with one or more objects with list, name and description fields. Name and description are optional but at least one of them must be present.

action=removeauthenticationdata

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Remove authentication data for the current user.

Specific parameters:
Other general parameters are available.
request

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=remove.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Attempt to remove the current user's data for FooAuthenticationRequest.
api.php?action=removeauthenticationdata&request=FooAuthenticationRequest&token=123ABC [open in sandbox]

action=resetpassword

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Send a password reset email to a user.

Specific parameters:
Other general parameters are available.
user

User being reset.

Type: user, by username
email

Email address of the user being reset.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Send a password reset email to user Example.
api.php?action=resetpassword&user=Example&token=123ABC [open in sandbox]
Send a password reset email for all users with email address [email protected].
api.php?action=resetpassword&[email protected]&token=123ABC [open in sandbox]

action=review

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: FlaggedRevs (Pending Changes)
  • License: GPL-2.0-or-later

Review a revision by approving or de-approving it.

Specific parameters:
Other general parameters are available.
revid

The revision ID for which to set the flags.

comment

Comment for the review.

unapprove

If set, revision will be unapproved rather than approved.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=revisiondelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Delete and undelete revisions.

Specific parameters:
Other general parameters are available.
type

Type of revision deletion being performed.

This parameter is required.
One of the following values: archive, filearchive, logging, oldimage, revision
target

Page title for the revision deletion, if required for the type.

ids

Identifiers for the revisions to be deleted.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
hide

What to hide for each revision.

Values (separate with | or alternative): comment, content, user
show

What to unhide for each revision.

Values (separate with | or alternative): comment, content, user
suppress

Whether to suppress data from administrators as well as others.

One of the following values: no, nochange, yes
Default: nochange
reason

Reason for the deletion or undeletion.

tags

Tags to apply to the entry in the deletion log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=rollback

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Undo the last edit to the page.

If the last user who edited the page made multiple edits in a row, they will all be rolled back.

Specific parameters:
Other general parameters are available.
title

Title of the page to roll back. Cannot be used together with pageid.

pageid

Page ID of the page to roll back. Cannot be used together with title.

Type: integer
tags

Tags to apply to the rollback.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
user

Name of the user whose edits are to be rolled back.

This parameter is required.
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
summary

Custom edit summary. If empty, default summary will be used.

Default: (empty)
markbot

Mark the reverted edits and the revert as bot edits.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
token

A "rollback" token retrieved from action=query&meta=tokens

For compatibility, the token used in the web UI is also accepted.

This parameter is required.
Examples:
Roll back the last edits to page Main Page by user Example.
api.php?action=rollback&title=Main%20Page&user=Example&token=123ABC [open in sandbox]
Roll back the last edits to page Main Page by IP user 192.0.2.5 with summary Reverting vandalism, and mark those edits and the revert as bot edits.
api.php?action=rollback&title=Main%20Page&user=192.0.2.5&token=123ABC&summary=Reverting%20vandalism&markbot=1 [open in sandbox]

action=rsd

(main | rsd)

Export an RSD (Really Simple Discovery) schema.

Example:
Export the RSD schema.
api.php?action=rsd [open in sandbox]

action=sanitize-mapdata

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: Kartographer
  • License: MIT

Performs data validation for Kartographer extension

Specific parameters:
Other general parameters are available.
title

Title of page on which this GeoJSON is supposed to be located. If no title is provided, a dummy one will be used.

Default: Dummy title (called from Kartographer\Api\ApiSanitizeMapData)
text

GeoJSON to sanitize

This parameter is required.

action=scribunto-console

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: Scribunto
  • License: GPL-2.0-or-later AND MIT

Internal module for servicing XHR requests from the Scribunto console.

Specific parameters:
Other general parameters are available.
title

The title of the module to test.

content

The new content of the module.

session

Session token.

Type: integer
question

The next line to evaluate as a script.

This parameter is required.
clear

Set to clear the current session state.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=securepollauth

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: SecurePoll
  • License: GPL-2.0-or-later

Allows a remote wiki to authenticate users before granting access to vote in the election.

Specific parameters:
Other general parameters are available.
token

A token based on the user's login token.

This parameter is required.
id

The ID of the user who intends to vote.

This parameter is required.
Type: integer
Example:
Authenticate user with ID 1, and login token 123ABC.
api.php?action=securepollauth&token=123ABC&id=1&format=json [open in sandbox]

action=setglobalaccountstatus

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CentralAuth
  • License: GPL-2.0-or-later

Hide or lock (or unhide or unlock) a global user account.

Specific parameters:
Other general parameters are available.
user

User to change the status of.

This parameter is required.
locked

Change whether this user is locked or not.

One of the following values: Can be empty, or lock, unlock
hidden

Change whether this user is not hidden, hidden from the global users list, or suppressed.

One of the following values: Can be empty, or lists, suppressed
reason

Reason for changing the user's status.

statecheck

Optional MD5 of the expected current userid:username:hidden:locked. This is used to detect edit conflicts. The value of hidden must be an empty string if not hidden or the strings lists or suppressed. The value of locked must be 1 for locked, 0 for unlocked. Examples: 2128506:LeeSmith::0; 3839611:VandalGoblin:suppressed:1.

token

A "setglobalaccountstatus" token retrieved from action=query&meta=tokens

This parameter is required.

action=setnotificationtimestamp

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Update the notification timestamp for watched pages.

This affects the highlighting of changed pages in the watchlist and history, and the sending of email when the "Email me when a page or a file on my watchlist is changed" preference is enabled.

Specific parameters:
Other general parameters are available.
entirewatchlist

Work on all watched pages.

Type: boolean (details)
timestamp

Timestamp to which to set the notification timestamp.

Type: timestamp (allowed formats)
torevid

Revision to set the notification timestamp to (one page only).

Type: integer
newerthanrevid

Revision to set the notification timestamp newer than (one page only).

Type: integer
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
geosearch
Returns pages having coordinates that are located in a certain area.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
oldreviewedpages
Enumerates pages that have changes pending review.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=setpagelanguage

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the language of a page.

Changing the language of a page is not allowed on this wiki.

Enable $wgPageLanguageUseDB to use this action.

Specific parameters:
Other general parameters are available.
title

Title of the page whose language you wish to change. Cannot be used together with pageid.

pageid

Page ID of the page whose language you wish to change. Cannot be used together with title.

Type: integer
lang

Language code of the language to change the page to. Use default to reset the page to the wiki's default content language.

This parameter is required.
One of the following values: aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, aig, ak, aln, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, ban, ban-bali, bar, bbc, bbc-latn, bcc, bci, bcl, bdr, be, be-tarask, bew, bg, bgc, bgn, bh, bho, bi, bjn, blk, bm, bn, bo, bol, bpy, bqi, br, brh, bs, btm, bto, bug, bug-bugi, bxr, ca, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, chr, chy, ckb, co, cop, cps, cpx, cpx-hans, cpx-hant, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, default, dga, din, diq, dlg, dsb, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, eo, es, es-formal, et, eu, ext, fa, fat, ff, fi, fit, fj, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, kg, kge, khw, ki, kiu, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mdf, mg, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mui, mwl, my, myv, mzn, nah, nan, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, nia, nit, niu, nl, nl-informal, nmz, nn, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, qug, rgn, rif, rki, rm, rmc, rmy, rn, ro, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shn, shy, shy-latn, si, sjd, sje, sk, skr, skr-arab, sl, sli, sm, sma, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, ss, st, stq, sty, su, sv, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, ti, tig, tk, tl, tly, tn, to, tok, tpi, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, wa, wal, war, wls, wlx, wo, wuu, wuu-hans, wuu-hant, xal, xh, xmf, xsy, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zh, zh-cn, zh-hans, zh-hant, zh-hk, zh-mo, zh-my, zh-sg, zh-tw, zu
reason

Reason for the change.

tags

Change tags to apply to the log entry resulting from this action.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Change the language of the page Main Page to Basque.
api.php?action=setpagelanguage&title=Main%20Page&lang=eu&token=123ABC [open in sandbox]
Change the language of the page with ID 123 to the wiki's default content language.
api.php?action=setpagelanguage&pageid=123&lang=default&token=123ABC [open in sandbox]

action=shortenurl

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: UrlShortener
  • License: Apache-2.0

Shorten a long URL into a shorter one.

Specific parameters:
Other general parameters are available.
url

URL to be shortened.

This parameter is required.
qrcode

Get a QR code. The linked URL will only be shortened if it is very long.

Type: boolean (details)

action=sitematrix (sm)

Get Wikimedia sites list.

The code (technically dbname/wikiid) is either the language code + project code for content projects or the subdomain + main domain for all the others.

Specific parameters:
Other general parameters are available.
smtype

Filter the Site Matrix by type:

special
One off and multilingual Wikimedia projects.
language
Wikimedia projects under this language code.
Values (separate with | or alternative): language, special
Default: special|language
smstate

Filter the Site Matrix by wiki state.

Values (separate with | or alternative): all, closed, fishbowl, nonglobal, private
Default: all
smlangprop

Which information about a language to return.

Values (separate with | or alternative): code, dir, localname, name, site
Default: code|name|site|dir|localname
smsiteprop

Which information about a site to return.

Values (separate with | or alternative): code, dbname, lang, sitename, url
Default: url|dbname|code|sitename
smlimit

Maximum number of results.

Type: integer or max
The value must be between 1 and 5,000.
Default: 5000
smcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Show the site matrix
api.php?action=sitematrix [open in sandbox]

action=spamblacklist

Validate one or more URLs against the spam block list.

Specific parameter:
Other general parameters are available.
url

URLs to validate against the block list.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=stabilize

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: FlaggedRevs (Pending Changes)
  • License: GPL-2.0-or-later

Configure review-protection settings for a page.

Specific parameters:
Other general parameters are available.
protectlevel

The review-protection level.

One of the following values: autoconfirmed, none
Default: none
expiry

Review-protection expiry.

Default: infinite
reason

Reason.

Default: (empty)
title

Title of the page to be review-protected.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=stashedit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Prepare an edit in shared cache.

This is intended to be used via AJAX from the edit form to improve the performance of the page save.

Specific parameters:
Other general parameters are available.
title

Title of the page being edited.

This parameter is required.
section

Section identifier. 0 for the top section, new for a new section.

sectiontitle

The title for a new section.

text

Page content.

stashedtexthash

Page content hash from a prior stash to use instead.

summary

Change summary.

Default: (empty)
contentmodel

Content model of the new content.

This parameter is required.
One of the following values: GadgetDefinition, Graph.JsonConfig, Json.JsonConfig, JsonSchema, MassMessageListContent, Scribunto, SecurePoll, css, javascript, json, sanitized-css, text, unknown, vue, wikitext
contentformat

Content serialization format used for the input text.

This parameter is required.
One of the following values: application/json, application/octet-stream, application/unknown, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
baserevid

Revision ID of the base revision.

This parameter is required.
Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=streamconfigs

  • This module requires read rights.
  • Source: EventStreamConfig
  • License: GPL-2.0-or-later

Exposes event stream config. Returns only format=json with formatversion=2.

Specific parameters:
Other general parameters are available.
streams

List of streams to get config for

Separate values with | or alternative.
Maximum number of values is 250 (500 for clients that are allowed higher limits).
constraints

Filter results for stream config entries that have these settings

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
all_settings
Deprecated.

Include all settings in stream config results. Deprecated since 1.41. All settings are included by default.

Type: boolean (details)

action=strikevote

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: SecurePoll
  • License: GPL-2.0-or-later

Allows admins to strike or unstrike a vote.

Specific parameters:
Other general parameters are available.
option

Which action to take: strike or unstrike a vote.

strike
Strike a vote (remove it from the count).
unstrike
Unstrike a vote (restore it to the count).
This parameter is required.
One of the following values: strike, unstrike
reason

The reason for striking or unstriking the vote.

This parameter is required.
voteid

The ID of the vote to be struck or unstruck.

This parameter is required.
Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=sxdelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Delete the draft section translation and its parallel corpora from database.

Specific parameters:
Other general parameters are available.
sectiontranslationid

The section translation id associated with the draft section translation.

This parameter is required.
Type: integer
translationid

The translation id associated with the draft section translation.

This parameter is required.
Type: integer
sectionid

The id of the section of the draft section translation.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Delete a draft associated with given translation id and section id.
api.php?action=sxdelete&translationid=1&sectionid=100_20 [open in sandbox]

action=sxsave

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: ContentTranslation
  • License: GPL-2.0-or-later

Save the draft section translation and store the parallel corpora

Specific parameters:
Other general parameters are available.
sourcelanguage

The source language code.

This parameter is required.
targetlanguage

The target language code.

This parameter is required.
sourcetitle

The title of the source page.

This parameter is required.
targettitle

The title of the target page.

This parameter is required.
content

JSON-encoded section data. Each section is an object and has the following keys: content, sectionId, origin, validate

This parameter is required.
sourcerevision

The source page revision id.

This parameter is required.
Type: integer
sourcesectiontitle

The title of the source section.

This parameter is required.
targetsectiontitle

The title of the target section.

This parameter is required.
sectionid

The page section id.

This parameter is required.
issandbox

Use a sandbox title for translation.

Type: boolean (details)
progress

The progress of the translation.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=tag

(main | tag)
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Add or remove change tags from individual revisions or log entries.

Specific parameters:
Other general parameters are available.
rcid

One or more recent changes IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revid

One or more revision IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
logid

One or more log entry IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
add

Tags to add. Only manually defined tags can be added.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
remove

Tags to remove. Only tags that are either manually defined or completely undefined can be removed.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
reason

Reason for the change.

Default: (empty)
tags

Tags to apply to the log entry that will be created as a result of this action.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Add the vandalism tag to revision ID 123 without specifying a reason
api.php?action=tag&revid=123&add=vandalism&token=123ABC [open in sandbox]
Remove the spam tag from log entry ID 123 with the reason Wrongly applied
api.php?action=tag&logid=123&remove=spam&reason=Wrongly+applied&token=123ABC [open in sandbox]

action=templatedata

Fetch data stored by the TemplateData extension.

Specific parameters:
Other general parameters are available.
includeMissingTitles

Return data about titles even if they are missing or lack TemplateData. By default titles are only returned if they exist and have TemplateData.

Type: boolean (details)
doNotIgnoreMissingTitles
Deprecated.

Return data about titles even if they are missing or lack TemplateData. By default (for backwards compatibility) titles are only returned if they exist and have TemplateData.

Type: boolean (details)
lang

Return localized values in this language. By default all available translations are returned.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
geosearch
Returns pages having coordinates that are located in a certain area.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
oldreviewedpages
Enumerates pages that have changes pending review.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
Examples:
Return TemplateData for Template:Foobar, with results if the template does not exist or exists but has no TemplateData
api.php?action=templatedata&titles=Template:Foobar&includeMissingTitles=1 [open in sandbox]
Return TemplateData for Template:Phabricator, with no results if the template does not exist or exists but has no TemplateData
api.php?action=templatedata&titles=Template:Phabricator [open in sandbox]

action=thank

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Thanks
  • License: MIT

Send a thank-you notification to an editor.

Specific parameters:
Other general parameters are available.
rev

Revision ID to thank someone for. This or 'log' must be provided.

Type: integer
The value must be no less than 1.
log

Log ID to thank someone for. This or 'rev' must be provided.

Type: integer
The value must be no less than 1.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
source

A short string describing the source of the request, for example diff or history.

Example:
Send thanks for revision ID 456, with the source being a diff page
api.php?action=thank&revid=456&source=diff&token=123ABC [open in sandbox]

action=timedtext

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: TimedMediaHandler
  • License: GPL-2.0-or-later

Provides timed text content for usage by <track> elements

Specific parameters:
Other general parameters are available.
title

The media file title for which to retrieve timed text

pageid

The pageid of the media file for which to retrieve timed text

Type: integer
trackformat

The file format in which to return timed text

This parameter is required.
One of the following values: srt, vtt
lang

The language of the timed text to retrieve

Example:
Fetch an SRT subtitle file in German for the file Example.ogv
api.php?action=timedtext&title=File:Example.ogv&lang=de&trackformat=vtt [open in sandbox]

action=titleblacklist (tb)

  • This module requires read rights.
  • Source: TitleBlacklist
  • License: GPL-2.0-or-later

Validate a page title, filename, or username against the TitleBlacklist.

Specific parameters:
Other general parameters are available.
tbtitle

The string to validate against the blacklist.

This parameter is required.
tbaction

The action to be checked.

One of the following values: create, createpage, createtalk, edit, move, new-account, upload
Default: edit
tbnooverride

Don't try to override the titleblacklist.

Type: boolean (details)

action=torblock

Check if an IP address is blocked as a Tor exit node.

Specific parameter:
Other general parameters are available.
ip

The IP address to check.

This parameter is required.
Example:
Check if the IP address 192.0.2.18 is blocked as a Tor exit node.
api.php?action=torblock&ip=192.0.2.18 [open in sandbox]

action=transcodereset

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: TimedMediaHandler
  • License: GPL-2.0-or-later

Users with the 'transcode-reset' right can reset and re-run a transcode job.

Specific parameters:
Other general parameters are available.
title

The media file title.

This parameter is required.
transcodekey

The transcode key you wish to reset. Fetch from action=query&prop=transcodestatus.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=ulslocalization

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Universal­Language­Selector
  • License: GPL-2.0-or-later OR MIT

Get the localization of ULS in the given language.

Specific parameter:
Other general parameters are available.
language

Language code.

This parameter is required.

action=ulssetlang

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: Universal­Language­Selector
  • License: GPL-2.0-or-later OR MIT

Update user's preferred interface language.

Specific parameters:
Other general parameters are available.
languagecode

The preferred language code.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=unblock

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Unblock a user.

Specific parameters:
Other general parameters are available.
id

ID of the block to unblock (obtained through list=blocks). Cannot be used together with user.

Type: integer
user

User to unblock. Cannot be used together with id.

Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
reason

Reason for unblock.

Default: (empty)
tags

Change tags to apply to the entry in the block log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
watchuser

Watch the user's or IP address's user and talk pages.

Type: boolean (details)
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=undelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Undelete revisions of a deleted page.

A list of deleted revisions (including timestamps) can be retrieved through prop=deletedrevisions, and a list of deleted file IDs can be retrieved through list=filearchive.

Specific parameters:
Other general parameters are available.
title

Title of the page to undelete.

This parameter is required.
reason

Reason for restoring.

Default: (empty)
tags

Change tags to apply to the entry in the deletion log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
timestamps

Timestamps of the revisions to undelete. If both timestamps and fileids are empty, all will be undeleted.

Type: list of timestamps (allowed formats)
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
fileids

IDs of the file revisions to restore. If both timestamps and fileids are empty, all will be restored.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
undeletetalk

Undelete all revisions of the associated talk page, if any.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=unlinkaccount

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Remove a linked third-party account from the current user.

Specific parameters:
Other general parameters are available.
request

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=unlink.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Attempt to remove the current user's link for the provider associated with FooAuthenticationRequest.
api.php?action=unlinkaccount&request=FooAuthenticationRequest&token=123ABC [open in sandbox]

action=upload

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Upload a file, or get the status of pending uploads.

Several methods are available:

  • Upload file contents directly, using the file parameter.
  • Upload the file in pieces, using the filesize, chunk, and offset parameters.
  • Have the MediaWiki server fetch a file from a URL, using the url parameter.
  • Complete an earlier upload that failed due to warnings, was uploaded in pieces, or stored otherwise in the upload stash, using the filekey parameter.

Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending the file or chunk.

Specific parameters:
Other general parameters are available.
filename

Target filename.

comment

Upload comment. Also used as the initial page text for new files if text is not specified.

Default: (empty)
tags

Change tags to apply to the upload log entry and file page revision.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
text

Initial page text for new files.

watch
Deprecated.

Watch the page.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, watch
Default: preferences
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
ignorewarnings

Ignore any warnings.

Type: boolean (details)
file

File contents.

Must be posted as a file upload using multipart/form-data.
url

URL to fetch the file from.

filekey

Key that identifies a previous upload that was stashed temporarily.

sessionkey
Deprecated.

Same as filekey, maintained for backward compatibility.

stash

If set, the server will stash the file temporarily instead of adding it to the repository.

Type: boolean (details)
filesize

Filesize of entire upload.

Type: integer
The value must be between 0 and 5,368,709,120.
offset

Offset of chunk in bytes.

Type: integer
The value must be no less than 0.
chunk

Chunk contents.

Must be posted as a file upload using multipart/form-data.
async

Make potentially large file operations asynchronous when possible.

Type: boolean (details)
checkstatus

Only fetch the upload status for the given file key.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=userrights

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change a user's group membership.

Specific parameters:
Other general parameters are available.
user

User.

Type: user, by any of username and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
add

Add the user to these groups, or if they are already a member, update the expiry of their membership in that group.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
expiry

Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: infinite
remove

Remove the user from these groups.

Values (separate with | or alternative): abusefilter, abusefilter-helper, accountcreator, autoreviewer, bot, bureaucrat, checkuser, confirmed, copyviobot, electionclerk, eventcoordinator, extendedconfirmed, extendedmover, filemover, founder, import, interface-admin, ipblock-exempt, massmessage-sender, no-ipinfo, patroller, researcher, reviewer, rollbacker, steward, suppress, sysop, templateeditor, temporary-account-viewer, transwiki
reason

Reason for the change.

Default: (empty)
token

A "userrights" token retrieved from action=query&meta=tokens

For compatibility, the token used in the web UI is also accepted.

This parameter is required.
tags

Change tags to apply to the entry in the user rights log.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle
watchuser

Watch the user's user and talk pages.

Type: boolean (details)
watchlistexpiry

Watchlist expiry timestamp. Omit this parameter entirely to leave the current expiry unchanged.

Type: expiry (details)
Examples:
Add user FooBot to group bot, and remove from groups sysop and bureaucrat.
api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
Add the user with ID 123 to group bot, and remove from groups sysop and bureaucrat.
api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
Add user SometimeSysop to group sysop for 1 month.
api.php?action=userrights&user=SometimeSysop&add=sysop&expiry=1%20month&token=123ABC [open in sandbox]

action=validatepassword

  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Validate a password against the wiki's password policies.

Validity is reported as Good if the password is acceptable, Change if the password may be used for login but must be changed, or Invalid if the password is not usable.

Specific parameters:
Other general parameters are available.
password

Password to validate.

This parameter is required.
user

Username, for use when testing account creation. The named user must not exist.

Type: user, by any of username and user ID (e.g. "#12345")
email

Email address, for use when testing account creation.

realname

Real name, for use when testing account creation.

Examples:
Validate the password foobar for the current user.
api.php?action=validatepassword&password=foobar [open in sandbox]
Validate the password qwerty for creating user Example.
api.php?action=validatepassword&password=querty&user=Example [open in sandbox]

action=visualeditor

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: VisualEditor
  • License: MIT

Returns HTML5 for a page from the Parsoid service.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

This parameter is required.
badetag

If RESTBase query returned a seemingly invalid ETag, pass it here for logging purposes.

format

The format of the output.

One of the following values: json, jsonfm
Default: jsonfm
paction

Action to perform.

This parameter is required.
One of the following values: metadata, parse, parsefragment, templatesused, wikitext
wikitext

Wikitext to send to Parsoid to convert to HTML (paction=parsefragment).

section

The section on which to act.

stash

When saving, set this true if you want to use the stashing API.

Type: boolean (details)
oldid

The revision number to use (defaults to latest revision).

Type: integer
editintro

Edit intro to add to notices.

pst

Pre-save transform wikitext before sending it to Parsoid (paction=parsefragment).

Type: boolean (details)
preload

The page to use content from if the fetched page has no content yet.

preloadparams

Parameters to substitute into the preload page, if present.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=visualeditoredit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: VisualEditor
  • License: MIT

Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).

Specific parameters:
Other general parameters are available.
paction

Action to perform.

This parameter is required.
One of the following values: diff, save, serialize, serializeforcache
page

The page to perform actions on.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
wikitext

The wikitext to act with.

section

The section on which to act.

sectiontitle

Title for new section.

basetimestamp

When saving, set this to the timestamp of the revision that was edited. Used to detect edit conflicts.

Type: timestamp (allowed formats)
starttimestamp

When saving, set this to the timestamp of when the page was loaded. Used to detect edit conflicts.

Type: timestamp (allowed formats)
oldid

The revision number to use. Defaults to latest revision.

Type: integer
minor

Flag for minor edit.

watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

html

HTML to send to Parsoid in exchange for wikitext.

etag

ETag to send.

summary

Edit summary.

captchaid

Captcha ID (when saving with a captcha response).

captchaword

Answer to the captcha (when saving with a captcha response).

cachekey

Use the result of a previous serializeforcache request with this key. Overrides html.

nocontent

Omit the HTML content of the new revision in the response.

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, cologneblue, contenttranslation, fallback, json, minerva, modern, monobook, timeless, vector, vector-2022
tags

Change tags to apply to the edit.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
plugins

Plugins associated with the API request.

ge-task-link-recommendation
Use when saving a GrowthExperiments "Add a link" structured edit.
ge-task-revise-tone
Use when saving a GrowthExperiments "Revise Tone" structured edit.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
data-{plugin}

Arbitrary data sent by a plugin with the API request.

For the ge-task-link-recommendation plugin

A JSON string of an object with these keys:

  • acceptedTargets: (optional) Array with the titles of pages, the recommended link to which was accepted by the user.
  • rejectedTargets: (optional) Array with the titles of pages, the recommended link to which was rejected by the user.
  • skippedTargets: (optional) Array with the titles of pages, the recommended link to which was skipped (ignored) by the user.
For the ge-task-revise-tone plugin
No data should be included for this plugin.
This is a templated parameter. When making the request, {plugin} in the parameter's name should be replaced with values of plugins.
mobileformat

Return parse output in a format suitable for mobile devices.

Type: boolean (details)

action=watch

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Add or remove pages from the current user's watchlist.

Specific parameters:
Other general parameters are available.
title
Deprecated.

The page to (un)watch. Use titles instead.

expiry

Expiry timestamp to be applied to all given pages. Omit this parameter entirely to leave any current expiries unchanged.

Type: expiry (details)
labels

Label IDs to assign to the pages being watched. This will replace all existing labels on the pages with the ones specified.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unwatch

If set the page will be unwatched rather than watched.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
geosearch
Returns pages having coordinates that are located in a certain area.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
mostviewed
Lists the most viewed pages (based on last day's pageview count).
oldreviewedpages
Enumerates pages that have changes pending review.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
projectpages
List all pages associated with one or more projects.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
growthtasks
Internal. Get task recommendations suitable for newcomers.
readinglistentries
Internal. List the pages of a certain list.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, geosearch, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, mostviewed, oldreviewedpages, pageswithprop, prefixsearch, projectpages, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, growthtasks, readinglistentries
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
token

A "watch" token retrieved from action=query&meta=tokens

This parameter is required.

action=webapp-manifest

  • This module requires read rights.
  • Source: MobileFrontend
  • License: GPL-2.0-or-later

Returns a webapp manifest.


action=webauthn

API Module to communicate between server and client during registration/authentication process.

Specific parameters:
Other general parameters are available.
func

Name of the requested function to be executed.

getAuthInfo
Authentication information.
getRegisterInfo
Registration information.
register
Register a new WebAuthn credential for the current user.
This parameter is required.
One of the following values: getAuthInfo, getRegisterInfo, register
passkeyMode

Whether the key being registered is in passkey mode. (Only for getRegisterInfo.)

Type: boolean (details)
credential

JSON-encoded WebAuthn credential response from the browser.

friendlyname

Friendly name for the new credential.

action=wikilove

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikiLove
  • License: MIT

Give WikiLove to another user.

WikiLove is a positive message posted to a user's talk page through a convenient interface with preset or locally defined templates. This action adds the specified wikitext to a certain talk page. For statistical purposes, the type and other data are logged.

Specific parameters:
Other general parameters are available.
title

Full pagename of the user page or user talk page of the user to send WikiLove to.

This parameter is required.
text

Raw wikitext to add in the new section.

This parameter is required.
message

Actual message the user has entered, for logging purposes.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
subject

Subject header of the new section.

This parameter is required.
type

Type of WikiLove (for statistics); this corresponds with a type selected in the menu, and optionally a subtype after that (e.g. as in "The Original Barnstar" or "A kitten for you!").

email

Content of the optional email message to send to the user. A warning will be returned if the user cannot be emailed. WikiLove will be sent to the user's talk page either way.

tags

Change tags to apply to the revision.

Values (separate with | or alternative): AFCH, AI-generated source, AWB, Addition of protection template to non-protected page, AntiVandal script, CVPI, CW-English-Converter, Deputy, HotCat, JWB, Newcomer task, New user adding protection template, ProveIt edit, RedWarn, RfC, Ultraviolet, WPCleaner, WikiLoop Battlefield, WikiShield script, XFDC, bot trial, changing time or duration, convenient-discussions, editProtectedHelper, excessive whitespace, fixed lint errors, huggle, invalid-timedtext-edit, large non-free file, massmove, moveToDraft, new user moving page out of userspace, ooze, pageswap, possible birth or death date change, possible formatting issues, pronoun-change, rapid date format changes, self-published-blog, self-published source, shortdesc helper, talk banner shell conversion, twinkle

action=wikimediaeventsblockededit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: WikimediaEvents
  • License: GPL-2.0-or-later

Log information about blocked edit attempts

Specific parameters:
Other general parameters are available.
page

A page on which an edit attempt was made

This parameter is required.
interface

The interface which was used to edit

This parameter is required.
One of the following values: discussiontools, mobilefrontend, other, visualeditor, wikieditor
platform

The platform which was used to edit

This parameter is required.
One of the following values: desktop, mobile

action=wikimediaeventshcaptchaeditattempt

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: WikimediaEvents
  • License: GPL-2.0-or-later

Log edit diff when hCaptcha challenge is shown but edit is incomplete

Specific parameters:
Other general parameters are available.
title

Page title

This parameter is required.
proposed_content

Proposed content text (max 8KB)

This parameter is required.
editing_session_id

Editing session ID

This parameter is required.
revision_id

Revision ID of the page being edited

This parameter is required.
Type: integer

format=json

Output data in JSON format.

Specific parameters:
Other general parameters are available.
callback

If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.

utf8

If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.

Type: boolean (details)
ascii

If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.

Type: boolean (details)
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=jsonfm

Output data in JSON format (pretty-print in HTML).

Specific parameters:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)
callback

If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.

utf8

If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.

Type: boolean (details)
ascii

If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.

Type: boolean (details)
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=none

Output nothing.

format=rawfm

Output data, including debugging elements, in JSON format (pretty-print in HTML).

Specific parameter:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)

format=xml

(main | xml)

Output data in XML format.

Specific parameter:
Other general parameters are available.
includexmlnamespace

If specified, adds an XML namespace.

Type: boolean (details)

format=xmlfm

Output data in XML format (pretty-print in HTML).

Specific parameters:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)
includexmlnamespace

If specified, adds an XML namespace.

Type: boolean (details)


// copied from User:DinhHuy2010/API

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.