Search Results: Codon
Redirect to:
- From a subtopic: This is a redirect from a subtopic of the target article or section.
- If the redirected subtopic could potentially have its own article in the future, then also tag the redirect with {{R with possibilities}} and {{R printworthy}}.
- To a section: This is a redirect from a topic that does not have its own page to a section of a page on the subject. For redirects to embedded anchors on a page, use {{R to anchor}} instead.
- From a cross-project redirect: This is a redirect from a title associated with an item on Wikidata. The Wikidata item associated with this page is codon (Q165052).
- Use this template only on hard redirects – for soft redirects use {{Soft redirect with Wikidata item}}.
Genetic code
Minggu, 2026-08-16 08:59:54within genetic material (DNA or RNA sequences of nucleotide triplets or codons) into proteins. Translation is accomplished by the ribosome, which links...
Click to read more »DNA and RNA codon tables
Rabu, 2026-05-13 07:53:00A codon table can be used to translate a genetic code into a sequence of amino acids. The standard genetic code is traditionally represented as an RNA...
Click to read more »Stop codon
Minggu, 2026-02-08 01:30:08In molecular biology, a stop codon (or termination codon) is a codon (nucleotide triplet within messenger RNA) that signals the termination of the translation...
Click to read more »Codon degeneracy
Senin, 2024-09-16 02:13:49Degeneracy or redundancy of codons is the redundancy of the genetic code, exhibited as the multiplicity of three-base pair codon combinations that specify...
Click to read more »Codon (disambiguation)
Kamis, 2024-11-28 00:36:10A codon is a three-base sequence of DNA that encodes a single amino acid in the genetic code Codon may also refer to: Codon (plant), a genus of plants...
Click to read more »Start codon
Kamis, 2026-01-22 08:50:57The start codon is the first codon of a messenger RNA (mRNA) transcript translated by a ribosome. The start codon always codes for methionine in eukaryotes...
Click to read more »Codon usage bias
Rabu, 2026-07-22 16:42:07Codon usage bias refers to differences in the frequency of occurrence of synonymous codons in coding DNA. A codon is a series of three nucleotides (a...
Click to read more »Nonsense mutation
Selasa, 2026-08-11 18:52:38point mutation in a sequence of DNA that results in a nonsense codon, or a premature stop codon in the transcribed mRNA, and leads to a truncated, incomplete...
Click to read more »Codon Adaptation Index
Kamis, 2026-07-30 10:15:46The Codon Adaptation Index (CAI) is the most widespread technique for analyzing codon usage bias. As opposed to other measures of codon usage bias, such...
Click to read more »Codon (planthopper)
Minggu, 2025-12-14 12:52:27Codon is a genus of planthoppers in the family Fulgoridae, subfamily Stronglyodematinae. Species occur in South Africa. Codon adrastus Fennah, 1967 Codon...
Click to read more »Open reading frame
Jumat, 2026-05-08 13:07:03frames are defined as spans of DNA sequence between the start and stop codons. Usually, this is considered within a studied region of a prokaryotic DNA...
Click to read more »Transfer RNA
Minggu, 2026-08-16 13:37:49tRNA specifies which three-nucleotide codon from the genetic code corresponds to which amino acid. Each mRNA codon is recognized by a particular type of...
Click to read more »Codon royenii
Selasa, 2025-12-16 17:07:14Codon royenii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also known...
Click to read more »Frameshift mutation
Rabu, 2026-06-10 05:56:41nature of gene expression by codons, the insertion or deletion can change the reading frame (the grouping of the codons), resulting in a completely different...
Click to read more »Codon schenckii
Selasa, 2025-12-16 17:07:37Codon schenckii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also...
Click to read more »Wobble base pair
Senin, 2026-01-12 21:33:16genetic code, there are 43 = 64 possible codons (three-nucleotide sequences). For translation, each of these codons requires a tRNA molecule with an anticodon...
Click to read more »Protein biosynthesis
Kamis, 2026-08-20 06:32:39corresponding to the mRNA codon, in the case of the start codon, this is the amino acid methionine. The next codon (adjacent to the start codon) is then bound by...
Click to read more »Effective number of codons
Selasa, 2025-07-22 21:19:49Effective number of codons (abbreviated as ENC or Nc) is a measure to study the state of codon usage biases in genes and genomes. The way that ENC is computed...
Click to read more »Ribosome
Selasa, 2026-08-11 19:15:32messenger RNA (mRNA). During translation, the ribosome decodes successive codons in an mRNA molecule and, with the aid of transfer RNA (tRNA), links amino...
Click to read more »Fatal insomnia
Jumat, 2026-08-14 23:46:18both carry a mutation at codon 178 of the prion protein gene. FFI is also invariably linked to the presence of the methionine codon at position 129 of the...
Click to read more »Expanded genetic code
Minggu, 2026-08-16 08:56:37is an artificially modified genetic code in which one or more specific codons have been re-allocated to encode an amino acid that is not among the 22...
Click to read more »Proteinogenic amino acid
Senin, 2026-08-03 15:02:34nearby UGA codon as selenocysteine (UGA is normally a stop codon). In some methanogenic prokaryotes, the UAG codon (normally a stop codon) can also be...
Click to read more »Chargaff's rules
Selasa, 2026-02-03 11:57:42encoded by the stop codons—TGA and TAG respectively.) The mismatch between the number of codons and amino acids allows several codons to code for a single...
Click to read more »Translation (biology)
Senin, 2026-07-13 10:18:06binding of complementary transfer RNA (tRNA) anticodon sequences to mRNA codons. The tRNAs carry specific amino acids that are chained together into a polypeptide...
Click to read more »Koudounia
Kamis, 2024-10-24 21:34:56The Koudounia (Greek: κουδούνια), are bell-like percussion instruments. Most often, they are made from copper and upon playing (that is, hitting them with...
Click to read more »Codon reassignment
Senin, 2026-08-17 06:13:22Typically codons, sets of three mRNA nucleotides, correspond to one specific amino acid. Codon reassignment is the exception to this rule. When a codon is reassigned...
Click to read more »Synonymous substitution
Minggu, 2025-11-16 21:43:34amino acids are coded for by more than one three-base-pair codon; since some of the codons for a given amino acid differ by just one base pair from others...
Click to read more »Candidate division SR1 and gracilibacteria code
Kamis, 2025-11-13 20:56:00UGA represents an additional glycine codon and does not code for termination. A survey of many genomes with the codon assignment software Codetta, analyzed...
Click to read more »Ka/Ks ratio
Selasa, 2026-04-14 15:58:58sequences as codons, groups of three nucleotides. Each codon represents a single amino acid in a protein chain. However, there are more codons (64) than...
Click to read more »Kozak consensus sequence
Senin, 2026-08-17 07:26:36is the initiation codon encoding a methionine amino acid at the N-terminus of the protein. (Rarely, GUG is used as an initiation codon, but methionine is...
Click to read more »Messenger RNA
Minggu, 2026-08-16 11:51:15are arranged into codons consisting of three ribonucleotides each. Each codon codes for a specific amino acid, except the stop codons, which terminate...
Click to read more »Wageningen University & Research
Kamis, 2026-08-13 12:10:44Since 1970 it has been organising different activities for its members. CODON is the study Association for all Biotechnology (BBT and MBT), Bioinformatics...
Click to read more »Codon (plant)
Kamis, 2025-12-18 04:09:31Codon is a small genus of plants from South Africa in the family Codonaceae in the order Boraginales. It is the only genus in the family, and comprises...
Click to read more »Split gene theory
Kamis, 2025-12-04 20:56:52permit short (< 600bp) open reading frames (ORFs) due to frequent stop codons. The short ORFs could have contained the short protein-coding exons observed...
Click to read more »Gene prediction
Minggu, 2026-08-09 20:34:11possible codons in the genetic code are stop codons, one would expect a stop codon approximately every 20–25 codons, or 60–75 base pairs, in a random sequence...
Click to read more »Eukaryotic translation termination factor 1
Selasa, 2026-08-11 23:06:30ERF1 gene. In Eukaryotes, eRF1 is an essential protein involved in stop codon recognition in translation, termination of translation, and nonsense mediated...
Click to read more »Nonsense-mediated decay
Selasa, 2026-07-21 04:03:16expression by eliminating mRNA transcripts that contain premature stop codons. Translation of these aberrant mRNAs could, in some cases, lead to deleterious...
Click to read more »Pancrustacea
Senin, 2026-08-10 05:09:59compositionally driven, synonymous codon-usage bias affects the nucleotide topology. As substitutions between serine codon families can proceed through threonine...
Click to read more »Ambush hypothesis
Rabu, 2025-12-17 23:56:51respect to codon usage, the ambush hypothesis theorizes that there is a positive correlation between the use of a codon and the amount a codon contributes...
Click to read more »Genetics
Selasa, 2026-08-18 01:52:39translation. Each group of three nucleotides in the sequence, called a codon, corresponds either to one of the twenty possible amino acids in a protein...
Click to read more »Methionine
Jumat, 2026-07-31 08:46:06was first isolated in 1921 by John Howard Mueller. It is encoded by the codon AUG. It was named by Satoru Odake in 1925, as an abbreviation of its structural...
Click to read more »Common descent
Selasa, 2026-08-11 17:41:55definitive evidence in favor of universal common descent. The way that codons (DNA triplets) are mapped to amino acids seems to be strongly optimised...
Click to read more »Pterobranchia
Senin, 2026-04-27 21:30:58of alternative codons in pterobranchs and comparison with the standard genetic code Genetic code Translation table DNA codon RNA codon Translation with...
Click to read more »Covarion
Kamis, 2022-06-02 15:46:20variable codons, is a technique in computational phylogenetics that allows the hypothesized rate of molecular evolution at individual codons in a set...
Click to read more »Micrococcus luteus
Rabu, 2026-08-05 04:38:322,501,097 bp. Micrococcus luteus was one of the early examples of novel codon usage, which led to the conclusion that the genetic code is not static,...
Click to read more »Silent mutation
Minggu, 2026-06-14 21:19:26the rare codon can affect the timing of translation, and in turn the co-translational folding of the protein. This is reflected in the codon usage bias...
Click to read more »Point mutation
Jumat, 2026-04-24 07:28:32termination codon (a stop was lost), resulting in abnormal extension of a protein's carboxyl terminus. Start-gain creates an AUG start codon upstream of...
Click to read more »Index of genetics articles
Rabu, 2026-05-20 10:19:50Allozyme Alternative splicing Altruism Alu family Alzheimer's disease Amber codon Ames test Amino acid Amino acid sequence Amino acids Amniocentesis Amorph...
Click to read more »Saturation mutagenesis
Minggu, 2026-06-07 02:34:11mutagenesis technique used in protein engineering, in which a single codon or set of codons is substituted with all possible amino acids at the position. There...
Click to read more »Aug
Sabtu, 2026-03-14 15:57:40the IMA symbol for the pyroxene mineral Augite AUG, the most common start codon, often encoding the amino acid methionine Augusta Railroad, defunct Arkansas...
Click to read more »Five prime untranslated region
Selasa, 2026-06-02 06:29:01of a messenger RNA (mRNA) that is directly upstream from the initiation codon. This region is important for the regulation of translation of a transcript...
Click to read more »Shine–Dalgarno sequence
Minggu, 2026-01-25 17:52:47messenger RNA. It is generally located around 8 bases upstream of the start codon AUG. The RNA sequence helps recruit the ribosome to the messenger RNA (mRNA)...
Click to read more »Gerstmann–Sträussler–Scheinker syndrome
Selasa, 2026-08-11 07:09:46P102L mutation, which causes a substitution of proline to a leucine in codon 102, has been found in the prion protein gene (PRNP, on chromosome 20) of...
Click to read more »Vertebrate mitochondrial code
Minggu, 2025-07-13 05:25:34vertebrata. AGA and AGG were thought to have become mitochondrial stop codons early in vertebrate evolution. However, at least in humans it has now been...
Click to read more »Ciliate, dasycladacean and hexamita nuclear code
Jumat, 2024-10-25 06:08:48The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae. AAs =...
Click to read more »Sequence logo
Minggu, 2025-07-06 00:48:06conserved bases around the initiation codon from all human mRNAs (Kozak consensus sequence). Note that the initiation codon is not drawn to scale, otherwise...
Click to read more »Mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code
Jumat, 2025-07-25 00:19:39with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon. AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...
Click to read more »Terminator (genetics)
Selasa, 2026-08-11 19:35:49phages. The Rho-dependent terminator occurs downstream of translational stop codons and consists of an unstructured, cytosine-rich sequence on the mRNA known...
Click to read more »Conformational proofreading
Jumat, 2026-08-21 13:02:38example, the ribosome has to select the correct tRNA that matches the mRNA codon among many structurally similar tRNAs. If the recognizer and its correct...
Click to read more »CodonCode Aligner
Selasa, 2025-09-30 01:49:30CodonCode Aligner is a commercial application for DNA sequence assembly, sequence alignment, and editing on Mac OS X and Windows. Features include chromatogram...
Click to read more »Creutzfeldt–Jakob disease
Sabtu, 2026-08-22 07:36:07influenced by a common polymorphism at codon 129 of the PRNP gene (methionine/valine). Notably, individuals homozygous at codon 129 are over-represented in sporadic...
Click to read more »Euplotid nuclear code
Minggu, 2025-07-20 15:48:44from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov...
Click to read more »Bacterial, archaeal and plant plastid code
Rabu, 2025-10-01 07:37:08variations in alternative start codons. A Possible start codons in NCBI table 1. AUG is most common. The two other start codons listed by table 1 (GUG and...
Click to read more »Condylostoma nuclear code
Jumat, 2025-07-25 00:04:0127 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Experimental evidence suggests that translation termination...
Click to read more »Central dogma of molecular biology
Jumat, 2026-08-07 18:19:02The encoding of proteins is done in groups of three, known as codons. The standard codon table applies for humans and mammals, but some other lifeforms...
Click to read more »Blastocrithidia nuclear code
Jumat, 2025-07-25 00:10:0927 and 28, is remarkable in that every one of the 64 possible codons can be a sense codon. AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...
Click to read more »RNA Tie Club
Selasa, 2026-04-28 19:14:09would be enough to define all 20 amino acids. This concept is the basis of "codons", and set an upper and lower limit on their size. Gamow had simply estimated...
Click to read more »Mitochondria
Rabu, 2026-08-19 23:11:58alternative mitochondrial codes. Further, the AUA, AUC, and AUU codons are all allowable start codons. Some of these differences should be regarded as pseudo-changes...
Click to read more »Biosynthesis
Senin, 2026-02-23 11:56:24that base pairs with specific nucleotide triplets on the mRNA called codons; codons encode a specific amino acid. This interaction is possible thanks to...
Click to read more »Leaky scanning
Selasa, 2026-01-27 06:54:455'UTR to locate a start codon to commence elongation. Sometimes, the scanning ribosome bypasses the initial AUG start codon and begins translation at...
Click to read more »Pyrrolysine
Selasa, 2026-08-11 15:59:26Pyrrolysine (symbol Pyl or O), encoded by the "amber" stop codon UAG, is a proteinogenic amino acid that is used in some methanogenic archaea and in bacteria...
Click to read more »Aromatase deficiency
Senin, 2026-04-13 09:57:20in a stop codon after 21 codons 0.0 Male C to A substitution in intron V, at 3' splicing acceptor site before exon VI Premature stop codon - Male Insertion...
Click to read more »Glossary of cellular and molecular biology (M–Z)
Minggu, 2026-07-26 15:11:28DNA or RNA into protein; any continuous stretch of codons that contains a start codon and a stop codon. operator A regulatory sequence within an operon...
Click to read more »Amino acid
Rabu, 2026-08-12 19:56:48Cahn-Ingold-Prelog sequence rules. Codons can also be expressed by: CGN, AGR. Codons can also be expressed by: CUN, UUR. Codons can also be expressed by: CTN...
Click to read more »Code
Jumat, 2026-08-21 07:07:58series of triplets (codons) of four possible nucleotides can be translated into one of twenty possible amino acids. A sequence of codons results in a corresponding...
Click to read more »Bacterial initiation factor
Kamis, 2025-11-13 21:30:21by mRNA binding, and starts codon-P-site interaction. IF2 enters with the initiator tRNA and places it on the start codon. GTP hydrolysis by IF2 releases...
Click to read more »Nonsense suppressor
Senin, 2025-05-26 03:13:00which can bind with a termination codon on mRNA; b) a mutation on ribosomes decreasing the effect of a termination codon. It is believed that nonsense suppressors...
Click to read more »GTG
Jumat, 2026-04-10 11:27:53Globe de Paris G2G Racing, an American stock car racing team GTG, a codon in the DNA codon table for the amino acid valine G2G, government-to-government, as...
Click to read more »Initiation factor
Selasa, 2026-06-02 06:30:30scanning and selection of the start codons. This can create changes in the selection of the factors, binding to different codons. Another important eukaryotic...
Click to read more »Major prion protein
Rabu, 2026-08-19 05:00:30familial insomnia is thought to be the result of a point mutation in PRNP at codon 178, which corroborates PrP's involvement in sleep-wake cycles. In addition...
Click to read more »Karyorelict nuclear code
Jumat, 2025-07-25 00:16:2328 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Translation termination probably relies on context, specifically...
Click to read more »Nucleic acid sequence
Minggu, 2026-08-16 13:08:38amino acids making up a protein strand. Each group of three bases, called a codon, corresponds to a single amino acid, and there is a specific genetic code...
Click to read more »P53
Minggu, 2026-08-16 09:29:39which lack part of the TAD and DBD. Alternative translation initiation at codons 40 or 160 results in ∆40p53 and ∆160p53 isoforms, respectively. p53 regulates...
Click to read more »Concomitant
Selasa, 2021-01-05 22:46:18same time as, or shortly after, another drug Concomitantly variable codon, a codon in a computational phylogenetic model in which the hypothesized rate...
Click to read more »Invertebrate mitochondrial code
Minggu, 2025-07-20 15:47:03Variation in translation of the mitochondrial genetic code occurs when DNA codons result in non-standard amino acids has been identified in invertebrates...
Click to read more »MANF
Senin, 2026-02-09 10:36:52numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is...
Click to read more »Site-directed mutagenesis
Kamis, 2026-06-04 01:52:39comprehensive approach is site saturation mutagenesis where one codon or a set of codons may be substituted with all possible amino acids at the specific...
Click to read more »MTRF1L
Kamis, 2025-07-31 21:51:48protein that functions as a releasing factor that recognizes termination codons and releases mitochondrial ribosomes from the synthesized protein (summary...
Click to read more »Python (programming language)
Jumat, 2026-08-21 17:55:14notable differences" For example, Codon uses 64-bit machine integers for speed, not arbitrarily as with Python; Codon developers claim that speedups over...
Click to read more »Alloprotein
Kamis, 2026-08-13 07:56:26redundancy of the 3 codons that encode a "stop" signal. If one of these can be substituted by another stop codon, then that codon can in principle be...
Click to read more »MRNA surveillance
Rabu, 2025-09-17 22:44:43for premature stop codons. The assembly of this complex is triggered by premature translation termination. If a premature stop codon is detected then the...
Click to read more »Substitution model
Selasa, 2026-04-28 16:41:22a codon substitution model (a codon is three bases and codes for one amino acid in a protein). There are 4 3 = 64 {\displaystyle 4^{3}=64} codons, resulting...
Click to read more »Marshall Warren Nirenberg
Jumat, 2026-04-10 20:41:56experiment). This greatly sped up the assignment of three-base codons to amino acids so that 50 codons were identified in this way. Khorana's experiments confirmed...
Click to read more »Wybutosine
Sabtu, 2025-10-04 15:33:13phenylalanine transfer RNA that stabilizes interactions between the codons and anti-codons during protein synthesis. Ensuring accurate synthesis of protein...
Click to read more »ACAT1 mRNA
Senin, 2026-01-19 19:42:42translation initiation codon to produce the normal 50-kDa ACAT1 protein but used an alternative translation initiation codon, GGC, to produce the novel...
Click to read more »Phyllodactylidae
Rabu, 2026-04-22 03:18:28phylogenetic analysis in 2008, and all members possess a unique single codon deletion in the phosducin (PDC) gene. The phyllodactylid genus Bogertia...
Click to read more »Phage-assisted continuous evolution
Senin, 2026-05-04 23:59:08addition of a TAG stop codon in the middle of gIII. Synthetases that aminoacylate the TAG codon's suppressor tRNA prevents stop codon activity, allowing for...
Click to read more »Eukaryotic initiation factor
Rabu, 2024-08-28 00:00:32stabilize the formation of ribosomal preinitiation complexes around the start codon and are an important input for post-transcription gene regulation. Several...
Click to read more »YTR
Minggu, 2026-02-01 20:34:00in the Royal Canadian Navy Leucine, represented in genetic codon code; see DNA and RNA codon tables You the Rock, Japanese hip-hop musician also known...
Click to read more »Missense mRNA
Minggu, 2026-08-16 13:02:49Missense mRNA is a messenger RNA bearing one or more mutated codons that yield polypeptides with an amino acid sequence different from the wild-type or...
Click to read more »P-site
Rabu, 2025-11-12 05:18:32the tRNA which is linked to the growing polypeptide chain. When a stop codon is reached, the peptidyl-tRNA bond of the tRNA located in the P-site is...
Click to read more »Sup35p
Sabtu, 2022-09-24 04:49:59polypeptide chain when the ribosome encounters a stop codon. While eRF1 recognizes stop codons, eRF3 facilitates the release of the polypeptide chain...
Click to read more »Parkinson's disease
Selasa, 2026-08-18 09:14:10(December 2018). Parkinson's Disease: Pathogenesis and Clinical Aspects. Codon Publications. ISBN 978-0-9944-3816-4. Greenland JC, Barker RA (2018). "The...
Click to read more »Absconditabacterales genetic code
Kamis, 2026-01-22 21:22:01translates UGA to glycine, and CGG and GCA to tryptophan, as determined by the codon assignment software Codetta; it was further shown that these recodings are...
Click to read more »Redundancy
Selasa, 2025-02-04 03:02:58methods in a user interface Codon redundancy, the redundancy of the genetic code exhibited as the multiplicity of three-codon combinations Cytokine redundancy...
Click to read more »K-mer
Senin, 2026-08-03 10:17:14non-overlapping 3-mers are called codons. While each codon only maps to one amino acid, each amino acid can be represented by multiple codons. Thus, the same amino...
Click to read more »List of genetic codes
Senin, 2026-03-30 10:21:40codes were discovered in bacterial genomes by Shulgina and Eddy using their codon assignment software Codetta, and validated by analysis of tRNA anticodons...
Click to read more »SECIS element
Kamis, 2026-08-13 08:22:14nucleotides) directs the cell to translate UGA codons as selenocysteines (UGA is normally a stop codon). SECIS elements are thus a fundamental aspect...
Click to read more »Poison exon
Minggu, 2026-08-16 09:34:37Poison exons (PEs); also called premature termination codon (PTC) exons or nonsense-mediated decay (NMD) exons] are a class of cassette exons that contain...
Click to read more »Pachysolen tannophilus nuclear code
Minggu, 2025-07-20 16:02:31(Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) This code uses the initiation codons AUG, GUG and UUG. Pachysolen tannophilus List of genetic codes This article...
Click to read more »GGG
Rabu, 2026-05-13 19:41:52language (ISO 639-3 code: ggg), a Rajasthani language of Pakistan GGG, a codon for the amino acid glycine 3G (disambiguation) G3 (disambiguation) This...
Click to read more »Boraginales
Kamis, 2025-12-18 04:17:07hard to characterize morphologically if it includes the genera Codon and Wellstedia. Codon was long regarded as an unusual member of Hydrophyllaceae, but...
Click to read more »Prion
Selasa, 2026-08-11 19:08:19identified an association between susceptibility to sCJD and a polymorphism at codon 129 in the PRNP gene, which encodes the prion protein (PrP). A homozygous...
Click to read more »Release factor
Selasa, 2026-08-11 19:14:32for the termination of translation by recognizing the termination codon or stop codon in an mRNA sequence. They are named so because they release new peptides...
Click to read more »Ataluren
Kamis, 2025-12-25 00:52:39premature stop codons (an effect referred to as "read-through") by promoting insertion of certain near-cognate tRNA at the site of nonsense codons with no apparent...
Click to read more »Tryptophan
Kamis, 2026-08-06 15:47:39serotonin, the hormone melatonin, and vitamin B3 (niacin). It is encoded by the codon UGG. Like other amino acids, tryptophan is a zwitterion at physiological...
Click to read more »Neutral mutation
Kamis, 2025-12-18 05:16:27specific tRNA molecules could recognize multiple codons. The area of the tRNA that recognizes the codon called the anticodon is able to bind multiple interchangeable...
Click to read more »Directionality (molecular biology)
Rabu, 2024-05-29 20:38:45N-terminus toward its C-terminus. For example, in a typical gene a start codon (5′-ATG-3′) is a DNA sequence within the sense strand. Transcription begins...
Click to read more »Yeast mitochondrial code
Jumat, 2025-07-25 00:04:50Valine (Val, V). The remaining CGN codons are rare in Saccharomyces cerevisiae and absent in Candida glabrata. The AUA codon is common in the gene var1 coding...
Click to read more »Alan Garen
Jumat, 2025-08-01 01:15:08suppressor mutations for tRNA. The Garen lab also showed that certain triplet codons (5'-UAG, 5'-UAA, and 5'-UGA) failed to bind amino acids. Thus, the Garen...
Click to read more »Protein
Selasa, 2026-08-11 19:08:58number of possible codons is 64; hence, there is some redundancy in the genetic code, with some amino acids specified by more than one codon. Genes encoded...
Click to read more »The Xenotext
Sabtu, 2026-07-11 00:02:04each of 26 codons, these being chosen out of the total of 64. These DNA codons would then be transcribed into the complementary RNA codons, which would...
Click to read more »Biomolecule
Selasa, 2026-06-16 00:06:11into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is incorporated into some proteins at a UAG codon. For instance, in some methanogens...
Click to read more »Mitochondrial translational release factor 1
Jumat, 2026-08-21 15:49:04termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein...
Click to read more »Xenobiology
Minggu, 2026-08-16 13:43:03nucleic acid (CeNA). The incorporation of XNA in a plasmid, involving 3 HNA codons, has been accomplished already in 2003. This XNA is used in vivo (E coli)...
Click to read more »Recode (database)
Jumat, 2019-10-04 10:55:09RECODE is a database of "programmed" frameshifts, bypassing and codon redefinition used for gene expression. Translational frameshift Baranov, P V; Gurvich...
Click to read more »O'Donnell-Luria–Rodan syndrome
Minggu, 2026-08-16 12:25:33directly to exon 13 (instead of exon 12). This creates a premature stop codon (amino acid position 378) in the gene's protein product, rendering it nonfunctional...
Click to read more »United Kingdom BSE outbreak
Selasa, 2026-06-23 02:54:39particular genetic makeup; those who were methionine-homozygous at the PRNP codon 129 methionine/valine polymorphism. Studies of similar diseases in other...
Click to read more »TTT
Selasa, 2026-08-04 21:08:45Typed Set Theory; see New Foundations Phenylalanine, an amino acid with the codon TTT Tilt table test, a medical test for dysautonomia and/or syncope The...
Click to read more »Consensus CDS Project
Jumat, 2025-12-12 09:17:13"Consensus" is defined as protein-coding regions that agree at the start codon, stop codon, and splice junctions, and for which the prediction meets quality...
Click to read more »Epstein syndrome
Rabu, 2026-07-22 19:54:48syndrome differs as it was more specifically linked to a mutation on the R702 codon on the MYH9 gene. Diseases with mutations on the MYH9 gene also include...
Click to read more »Candida (fungus)
Sabtu, 2026-02-28 04:27:35genetic code between species possessing this alternative code is that the codon CUG (normally encoding the amino acid leucine) is translated by the yeast...
Click to read more »Trinucleotide repeat disorder
Minggu, 2026-04-19 01:04:04translation initiated at the usual AUG or a similar (CUG, GUG, UUG, or ACG) start codon. This results in expression of a pathogenic protein encoded by one particular...
Click to read more »Paul M. Sharp
Sabtu, 2025-10-04 03:43:26Sharp, Paul M.; Li, Wen-Hsiung (1987). "The codon adaptation index-a measure of directional synonymous codon usage bias, and its potential applications"...
Click to read more »Exon shuffling
Sabtu, 2025-11-01 00:40:37codons (phase 0 introns), between the first and second nucleotide of a codon (phase 1 introns), or between the second and third nucleotide of a codon...
Click to read more »GC-content
Jumat, 2026-01-30 02:23:32to higher G+C content. This has been pointed to the fact that the stop codon has a bias towards A and T nucleotides, and, thus, the shorter the sequence...
Click to read more »Amino acid replacement
Sabtu, 2026-06-06 18:31:53sequence. It is caused by a nonsynonymous missense mutation which changes the codon sequence to code for a different amino acid than the original sequence....
Click to read more »Phi X 174
Minggu, 2026-08-16 00:59:21start codon within the large A genes. Only genes A* and K are thought to be non-essential, although there is some doubt about A* because its start codon could...
Click to read more »Nirenberg and Matthaei experiment
Kamis, 2026-04-09 21:20:50of Health (NIH). The experiment deciphered the first of the 64 triplet codons in the genetic code by using nucleic acid homopolymers to translate specific...
Click to read more »Termination signal
Sabtu, 2026-07-25 04:14:37terminators. In the context of translation, a termination signal is the stop codon on the mRNA that elicits the release of the growing peptide from the ribosome...
Click to read more »Ribosome shunting
Kamis, 2025-10-02 22:11:41or "shunt over", parts of the 5' untranslated region to reach the start codon. However, a benefit of ribosomal shunting is that it can translate backwards...
Click to read more »Phenylalanine
Rabu, 2026-08-05 00:34:29and the biological pigment melanin. It is encoded by the messenger RNA codons UUU and UUC. The one-letter symbol F was assigned to phenylalanine for its...
Click to read more »NC
Selasa, 2025-12-16 16:07:29transient component of the ectoderm Effective number of codons, a measure to study the state of codon usage biases in genes (-NC) Isocyanide, an organic functional...
Click to read more »Tyrosine
Jumat, 2026-04-10 20:14:25amino acid, it is more hydrophilic than phenylalanine. It is encoded by the codons UAC and UAU in messenger RNA. The one-letter symbol Y was assigned to tyrosine...
Click to read more »Gag/pol translational readthrough site
Rabu, 2021-03-31 05:03:44readthrough site facilitates the mechanism of translation readthrough of the stop codon at the gag-pol junction producing the gag and pol fusion protein in certain...
Click to read more »Ascidian mitochondrial code
Rabu, 2026-05-13 19:08:18sequencing whole mitochondrial genomes. ATA, GTG and TTG ATT is the start codon for the CytB gene in Halocynthia roretzi. List of genetic codes This article...
Click to read more »Termination factor
Jumat, 2023-08-18 15:10:06Protein signal which causes the release of transcribed RNA at a stop codon...
Click to read more »Missense mutation
Minggu, 2026-08-16 13:02:50mutation is a point mutation in which a single nucleotide change results in a codon that codes for a different amino acid. It is a type of nonsynonymous substitution...
Click to read more »TXNRD1
Minggu, 2025-11-23 05:22:16required for catalytic activity. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenocysteine-containing...
Click to read more »Coudons
Jumat, 2026-07-03 19:59:56Coudons (French: [kudɔ̃] ; Occitan: Codons) is a commune in the Aude department in southern France. Communes of the Aude department "Répertoire national...
Click to read more »Eric Westhof
Minggu, 2025-10-05 13:33:2964 codons is circular with an asymmetric distribution of codons that leads to a clear segregation between GC-rich 4-codon boxes and AU-rich 2:2-codon and...
Click to read more »CCC
Selasa, 2026-07-07 20:17:06ammeter cccDNA (covalently closed circular DNA), a special form of DNA CCC, a codon for the amino acid proline Chaos Computer Club, hacker organisation Citizen...
Click to read more »Tag
Rabu, 2026-08-12 01:10:53shortened to TAG Tumor-associated glycoprotein, a type of protein TAG, a stop codon Tag (game), a playground game Tag (horse), an 18th-century thoroughbred...
Click to read more »Cornish Rex
Senin, 2026-07-27 17:31:59identified to have a 4 base pair deletion. This induces a premature stop codon in the receptor that is absent in all straight haired cats analyzed. LPAR6...
Click to read more »Suppressor mutation
Sabtu, 2025-11-15 09:38:53study it was shown that genes are expressed as non-overlapping triplets (codons). Researchers showed that mutations caused by either a single base insertion...
Click to read more »Translational regulation
Minggu, 2025-06-08 22:01:22primarily targeted on the control of ribosome recruitment on the initiation codon, but can also involve modulation of peptide elongation, termination of protein...
Click to read more »Virus
Minggu, 2026-08-16 15:05:01E, Mueller S (June 2008). "Virus attenuation by genome-scale changes in codon pair bias". Science. 320 (5884): 1784–87. Bibcode:2008Sci...320.1784C. doi:10...
Click to read more »COVID-19 lab leak theory
Selasa, 2026-08-18 13:23:20cytosine-guanine-guanine (CGG) codons in the virus' RNA, more precisely in the crucial furin cleavage site. The CGG codon is one of several codons that translates into...
Click to read more »Glutamine
Selasa, 2026-08-11 23:16:28increases, and glutamine must be obtained from the diet. It is encoded by the codons CAA and CAG. It is named after glutamic acid, which in turn is named after...
Click to read more »Venki Ramakrishnan
Sabtu, 2026-06-27 01:58:59Anti-codon recognition leaves the "wobble" base free to accommodate certain non-Watson/Crick basepairs, thus providing an atomic description of both codon:anti-codon...
Click to read more »CAG
Sabtu, 2026-02-14 00:40:54forum which provides free help and support on all consumer issues CAG, a codon that encodes the α-amino acid glutamine CAG, ISO provincial code for the...
Click to read more »Stop-loss
Jumat, 2023-12-29 10:12:16discharge date Stop-loss variant, a genetic variant that causes loss of a stop codon Stop-Loss (film), a 2008 film about soldiers subject to the stop-loss policy...
Click to read more »Biology
Minggu, 2026-08-02 13:56:05Holley and Marshall Warren Nirenberg after DNA was understood to contain codons. The Human Genome Project was launched in 1990 to map the human genome....
Click to read more »Nancy Pelosi
Jumat, 2026-08-07 15:25:47After Health Care Vote – CBS News". CBS News. Retrieved October 29, 2023. Codon, Stephanie (March 22, 2010). ""Fire Nancy Pelosi" Becomes GOP Slogan After...
Click to read more »AUU
Rabu, 2022-03-23 10:17:52AUU may refer to: an abbreviation for Adelaide University Union AUU, a codon for the amino acid isoleucine Aurukun Airport, IATA airport code "AUU" This...
Click to read more »GAA
Minggu, 2026-02-22 00:25:19alpha-glucosidase, also known as glucosidase, alpha; acid, an enzyme a codon for glutamic acid GADA 601, Argentine Army unit Grupo de Artillería Antiaérea...
Click to read more »CRACD-like protein
Minggu, 2026-05-17 17:14:01Translation CRACDL Part 1. The upstream stop codon is orange, the exon boundaries are highlighted blue, the start codon is green, the predicted nuclear location...
Click to read more »Histidine
Jumat, 2026-07-31 20:13:57longer-term studies to be essential for adults also. It is encoded by the codons CAU and CAC. Histidine was first isolated by Albrecht Kossel and Sven Gustaf...
Click to read more »Transfer-messenger RNA
Kamis, 2025-10-02 11:02:49example when reaching the end of a messenger RNA which has lost its stop codon. The tmRNA is remarkably versatile: it recycles the stalled ribosome, adds...
Click to read more »N1-Methylguanosine
Senin, 2025-12-01 21:36:11occurs in all transfer RNAs (tRNAs) that read codons starting with C except in those tRNAs that read CAN codons. m1G can help prevent errors in protein synthesis...
Click to read more »CGG
Jumat, 2024-06-28 18:26:29South Carolina, US Campaign for Good Governance, in Sierra Leone CGG, a codon for the amino acid arginine CGG repeats, a trinucleotide repeat disorder;...
Click to read more »Candida albicans
Kamis, 2026-08-13 07:35:28albicans and C. tropicalis, but not, for instance, C. glabrata) the CUG codon, which normally specifies leucine, specifies serine in these species. This...
Click to read more »Primer (molecular biology)
Jumat, 2026-01-30 04:57:49because the genetic code itself is degenerate, meaning several different codons can code for the same amino acid. This allows different organisms to have...
Click to read more »Cytosine
Selasa, 2026-08-11 17:46:10in a codon of RNA, cytosine is synonymous with uracil, as they are interchangeable as the third base. When found as the second base in a codon, the third...
Click to read more »UAU
Jumat, 2025-08-22 04:19:26University, a state health sciences university in Uttarakhand, India A codon for the amino acid tyrosine UAU: A subunit of South Korean girl group, Dreamcatcher...
Click to read more »Ribosomal frameshift
Minggu, 2026-08-16 09:40:36as codons, from one end of the mRNA to the other (from the 5' to the 3' end) starting with the amino acid methionine as the start (initiation) codon AUG...
Click to read more »Selenocysteine
Selasa, 2026-06-02 06:26:44code. Instead, it is encoded in a special way by a UGA codon, which is normally the "opal" stop codon. Such a mechanism is called translational recoding and...
Click to read more »Asparagine
Rabu, 2026-07-01 10:40:12non-essential in humans, meaning the body can synthesize it. It is encoded by the codons AAU and AAC. The one-letter symbol N for asparagine was assigned arbitrarily...
Click to read more »BED (file format)
Senin, 2024-09-09 10:34:46displayed in a thicker way on a graphical representation (e.g.: the start codon of a gene) No 8 thickEnd End coordinates from which the annotation is no...
Click to read more »NKAPD1
Senin, 2025-11-10 17:36:06nt NP_001287948.1 264 aa Alternate exons 1 and 2, uses alternate start codon 7 isoform d NM_001301021.2 3166 nt NP_001287950.1 263 aa Alternate exons...
Click to read more »Mutation
Minggu, 2026-08-16 23:05:29nature of gene expression by codons, the insertion or deletion can disrupt the reading frame, or the grouping of the codons, resulting in a completely different...
Click to read more »Bacterial translation
Senin, 2026-06-29 09:47:01initiation codons are those of lacI (GUG) and lacA (UUG) in the E. coli lac operon. Two studies have independently shown that 17 or more non-AUG start codons may...
Click to read more »Arginine
Kamis, 2026-08-06 15:28:34naturally. Arg residues are common components of proteins. It is encoded by the codons CGU, CGC, CGA, CGG, AGA, and AGG. The guanidine group in arginine is the...
Click to read more »Alanine
Selasa, 2026-08-11 22:22:32and its carboxyl group deprotonated (as −CO−2). Alanine is encoded by all codons starting with GC (GCU, GCC, GCA, and GCG). The L-isomer of alanine (left-handed)...
Click to read more »Leucine
Selasa, 2026-08-11 18:31:11products, soy products, and beans and other legumes. It is encoded by the codons UUA, UUG, CUU, CUC, CUA, and CUG. Leucine is named after the Greek word...
Click to read more »GAT
Senin, 2026-06-15 22:38:10an enzyme Galactoside acetyltransferase, an enzyme Aspartic acid (codon: GAT), an amino acid Khat (or gat), a stimulant plant Gat air pistol, a...
Click to read more »Glutathione peroxidase 3
Kamis, 2025-07-17 23:43:42(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing...
Click to read more »Codonopsis
Jumat, 2025-11-14 22:41:42f9c186b5-5bdf-42f6-b105-b8071c370c67 Open Tree of Life: 670513 PLANTS: CODON POWO: urn:lsid:ipni.org:names:5656-1 Tropicos: 40011401 WFO: wfo-4000008798...
Click to read more »Mdx mouse
Kamis, 2026-05-07 01:47:10in its DMD gene, changing the amino acid coding for a glutamine to STOP codon. This causes the muscle cells to produce a small, nonfunctional dystrophin...
Click to read more »Frameshift mutation experiment
Selasa, 2026-08-11 20:25:11series of three base pair codons which code for individual amino acids; this "triplet-code" is summarized in DNA and RNA codon tables. The experiment also...
Click to read more »AAA
Minggu, 2026-08-16 15:31:10American Accounting Association American Arbitration Association AAA, a codon for the amino acid lysine Amino acid analysis Aromatic amino acids Arylalkanolamine...
Click to read more »AUC
Senin, 2026-03-02 15:27:52Analytical ultracentrifugation, Physical and biophysical chemistry instrument a codon for the amino acid isoleucine Aalborg University, formerly Aalborg University...
Click to read more »University of Michigan Medical School
Sabtu, 2026-08-15 01:55:42Nobel Prize in Physiology or Medicine (1968) for the elucidation of how codons are utilized for protein synthesis Antonia Novello – first woman and first...
Click to read more »Proline
Kamis, 2026-05-07 03:55:27from the non-essential amino acid L-glutamate. It is encoded by all the codons starting with CC (CCU, CCC, CCA, and CCG). Proline is the only proteinogenic...
Click to read more »Protein metabolism
Rabu, 2026-05-13 04:07:23mRNA sequence contains codons: 3 nucleotide long segments that code for a specific amino acid. Ribosomes translate the codons to their respective amino...
Click to read more »Variably protease-sensitive prionopathy
Minggu, 2026-08-16 13:40:26protease-sensitive. VPSPr affects those who possess each of three genotypes at codon 129 of the PrP gene, meaning VPSPr can manifest as three different subtypes:...
Click to read more »CUU
Jumat, 2021-11-12 02:47:43established in Kampala in 2008 Cursor Up (ANSI), an ANSI X3.64 escape sequence a codon for the amino acid leucine This disambiguation page lists articles associated...
Click to read more »Prime editing-mediated readthrough of premature termination codons
Senin, 2025-12-29 09:48:09Prime editing-mediated readthrough of premature termination codons (PERT) is a genome-editing strategy that corrects nonsense mutations. The method converts...
Click to read more »Chlorophycean mitochondrial code
Jumat, 2025-07-25 00:09:35Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33...
Click to read more »Coding strand
Sabtu, 2024-06-08 15:36:32(although with thymine replaced by uracil). It is this strand which contains codons, while the non-coding strand contains anticodons. During transcription,...
Click to read more »Genetic saturation
Kamis, 2025-12-18 22:58:29of interest at its two ends. Only one codon of a three codon amino acid sequence is substituted. The type of codon set, will determine the number of sequences...
Click to read more »Marilyn Kozak
Minggu, 2026-07-19 23:31:19Kozak, M (1987). "At least six nucleotides preceding the AUG initiator codon enhance translation in mammalian cells". J Mol Biol. 196 (4): 947–50. doi:10...
Click to read more »Arthur Beaudet
Selasa, 2026-05-19 11:44:001967. His medical dissertation at Yale was titled, "Differences in RNA codon recognition as a function of cellular tRNA content". Beaudet completed a...
Click to read more »Serine
Rabu, 2026-08-12 17:14:41circumstances, making it a nonessential amino acid. It is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC. This compound is one of the proteinogenic...
Click to read more »EIF1
Selasa, 2026-08-11 17:53:35complex in search of the translation initiation start codon. Accurate identification of the start codon is very important, as other translation start sites...
Click to read more »Cystic fibrosis
Minggu, 2026-08-16 11:53:16ribosome to overcome the stop codon and produce a full-length CFTR protein. About 10% of CF results from a premature stop codon in the DNA, leading to early...
Click to read more »Paramecium
Kamis, 2026-07-30 05:11:14Paramecium, only UGA is decoded as a stop codon, while UAG and UAA are reassigned as sense codons (that is, codons that code for standard amino acids), coding...
Click to read more »Datura stramonium
Selasa, 2026-08-11 22:54:47other. Tropane alkaloid biosynthesis is another avenue of defense with codons positively selected and expanded in the Datura branch. It is aided by the...
Click to read more »Single-nucleotide polymorphism
Minggu, 2026-08-16 13:28:231580 (nt) in the DNA sequence (CGT codon) causing the guanine to be replaced with the thymine, yielding CTT codon in the DNA sequence, results at the...
Click to read more »List of gaited horse breeds
Rabu, 2025-11-26 05:49:53circuits related to limb movement and motion, causes a "premature 'stop codon'" in horses with lateral ambling gaits. Such breeds include the following:...
Click to read more »TTG
Minggu, 2026-08-09 01:15:34of Archean age Transmit/receive transition gap in communications TTG, a codon for the amino acid Leucine TTG Studios, Los Angeles, US Travel Trade Gazette...
Click to read more »FASTA format
Senin, 2026-06-29 09:15:52Isoleucine J Leucine (L) or Isoleucine (I) K Lysine L Leucine M Methionine/Start codon N Asparagine O Pyrrolysine (rare) P Proline Q Glutamine R Arginine S Serine...
Click to read more »Lumacaftor
Sabtu, 2026-01-10 19:05:42lumacaftor had no medical use on its own. Ataluren, targeting premature stop codons Kuk K, Taylor-Cousar JL (December 2015). "Lumacaftor and ivacaftor in the...
Click to read more »Trp operon
Kamis, 2025-11-13 20:25:58Arg, Thr, Ser; conservation is observed in these 5 codons whereas mutating the upstream codons do not alter the operon expression. If the ribosome attempts...
Click to read more »Anelloviridae
Jumat, 2026-05-22 00:14:27open reading frames, ORF1 and ORF2. They initiate at two different AUG codons. Additional ORFs can be formed as well. These ORFs may overlap partially...
Click to read more »Adeno-associated virus
Selasa, 2026-08-11 20:51:00codon, from which the synthesis of VP1 protein starts, is cut out, resulting in a reduced overall level of VP1 protein synthesis. The first AUG codon...
Click to read more »Cysteine
Senin, 2026-08-17 09:47:35food additive, cysteine has the E number E920. Cysteine is encoded by the codons UGU and UGC. Like other amino acids (not as a residue of a protein), cysteine...
Click to read more »Matthew Garrett
Minggu, 2026-07-26 03:58:30Employer NVIDIA Known for Free software development and advocacy Awards Free Software Award Website mjg59.dreamwidth.org or codon.org.uk/~mjg59/blog/...
Click to read more »Ascoidea asiatica
Jumat, 2025-10-24 03:30:43and the Max-Planck Institute for Biophysical Chemistry that the CUG sense codon in this yeast is translated by two different tRNAs, one coding for serine...
Click to read more »Synthetic Gene Database
Sabtu, 2022-08-06 07:39:29optimizing protein over-expression. Contact Primary citation Wu & al. (2007) Release date 2006 Access Website http://www.umbc.edu/codon/sgdb/index.php...
Click to read more »C6orf47
Minggu, 2026-06-28 21:25:41Clinical Significance Rs963273525 Amino Acid 1 TC MetVal Missense In start codon (CDS) N/A Rs1800736098 Base pair 8 CA N/A Transversion mutation Conserved...
Click to read more »Mutant protein
Rabu, 2022-02-23 08:02:06changes by e.g. truncation of C-terminus after introducing premature stop codon. Site-directed mutagenesis Phi value analysis missense mutation nonsense...
Click to read more »Sense (molecular biology)
Senin, 2026-04-06 15:32:31messenger RNA (mRNA) transcript, and can therefore be used to read the expected codon sequence that will ultimately be used during translation (protein synthesis)...
Click to read more »Mycoplasma
Rabu, 2026-06-17 03:27:13arthropod hosts. Dietary nitrogen availability has been shown to alter codon bias and genome evolution in Mycoplasma and the plant parasites Phytoplasma...
Click to read more »DNA
Minggu, 2026-08-16 08:47:53three-letter 'words' called codons formed from a sequence of three nucleotides (e.g., ACT, CAG, TTT). In transcription, the codons of a gene are copied into...
Click to read more »Familial adenomatous polyposis
Minggu, 2026-07-26 14:42:08mouse model was described in 1990 and carries an Apc allele with a stop codon at position 850. Heterozygosity for this mutation results in a fully penetrant...
Click to read more »Hh blood group
Jumat, 2026-08-21 19:29:26Tyr316Ter mutation in the coding region of FUT1. The mutation introduces a stop codon, leading to a truncated enzyme that lacks 50 amino acids at the C-terminal...
Click to read more »Artificial life
Sabtu, 2026-08-22 12:31:02Escherichia coli, by reducing the natural number of 64 codons in the bacterial genome to 59 codons instead, in order to encode 20 amino acids. In 2020,...
Click to read more »Scenedesmus obliquus mitochondrial code
Minggu, 2025-07-13 12:11:13DNA codons RNA codons This code (22) Standard code (1) TCA UCA STOP = Ter (*) Ser (S) TAG UAG Leu (L) STOP = Ter (*)...
Click to read more »Lysidine (nucleoside)
Senin, 2025-08-25 07:35:42i.e. the wobble base, in the anti-codon of the eubacterial isoleucine-specific tRNA pertaining to the AUA codon is typically changed from a cytidine...
Click to read more »RyhB
Rabu, 2025-11-12 02:35:39with its putative binding interaction to the target mRNA sodB. The start codon for sodB is underlined. RyhB nucleotides that participate in the interaction...
Click to read more »Scarlet fever
Selasa, 2026-08-11 19:20:33terminator is located 69 bases downstream from the translational termination codon. The carboxy terminal portion of the protein exhibits extensive homology...
Click to read more »Kinetic proofreading
Selasa, 2026-04-07 22:08:14the codons match or not by examining whether the codon and anticodon are bound will not be able to tell the difference between wrong and right codon with...
Click to read more »Penicillium roqueforti
Minggu, 2026-08-16 15:32:53ORF 11 of the PR toxin biosynthetic cluster introduces a premature stop codon; a deletion in the lipase/esterase domain of the mpaC gene prevents MPA...
Click to read more »Echinoderm and flatworm mitochondrial code
Minggu, 2025-07-13 12:09:07DNA codons RNA codons This code (9) Standard code (1) AAA AAA Asn (N) Lys (K) AGA AGA Ser (S) Arg (R) AGG AGG Ser (S) Arg (R) TGA UGA Trp (W) STOP = Ter...
Click to read more »Scientific method
Sabtu, 2026-08-08 05:41:07Crick. (Of course, 'unlike with unlike' increases the number of possible codons, if this scheme were a genetic code.) Goldstein, Bernard R. (1977) Ibn Mu'adh's...
Click to read more »Helicobacter pylori
Selasa, 2026-08-11 18:15:02the AAGGag motif located about 6 nt (median distance) upstream of start codons as the consensus Shine–Dalgarno sequence in H. pylori. The proteome of H...
Click to read more »SPMIP2
Minggu, 2026-08-16 13:24:52include exon boundaries, poly A signal, poly A site, and start and stop codons. Protein annotations include a domain of unknown function (DUF4562), FHA...
Click to read more »TEDC2
Sabtu, 2025-07-19 14:29:34are found in the 6 TEDC2 isoforms. Green = contains a start codon. Red = contains a stop codon. Check = Exon included in the final mRNA transcript. -- =...
Click to read more »MFSD6L
Kamis, 2025-10-30 23:21:54Position Original Nucleotide SNP Original Amino Acid Variant Amino Acid Codon 328 1212 T T Ser [S] Leu [L] 2 399 1424 G A Gly [G] Ser [S] 1 406 1446 C...
Click to read more »Beta-1 adrenergic receptor
Sabtu, 2026-07-18 15:51:13switch from arginine (389R) to glycine (389G) at the 389 codon position. Arginine at codon 389 is highly preserved across species and this mutation happens...
Click to read more »ATT
Minggu, 2026-06-28 12:16:46association Attachment, the binding of a virus to its target cell ATT, a codon for the amino acid isoleucine A.T.T., a British dance music act Hamdan ATT...
Click to read more »Progressive bulbar palsy
Senin, 2026-03-30 03:40:25deletion in the 126th codon in exon 5 of the SOD1 gene. This mutation produced a frameshift mutation, which led to a stop codon at position 131. SOD1...
Click to read more »Sandhoff disease
Minggu, 2026-05-10 06:54:13the differences in the various mutations of the genome, in particular the codons on the 14 exons in the HEXB gene located within chromosome 5 (see figure...
Click to read more »Lattice corneal dystrophy
Selasa, 2025-11-11 00:11:17Diagram depicting gelsolin and the amyloid protein derived from it because of mutations in codon...
Click to read more »Hepatitis A
Minggu, 2026-08-16 12:42:00one serotype of the virus has been found, but multiple genotypes exist. Codon use within the genome is biased and unusually distinct from its host. It...
Click to read more »Metastasis
Selasa, 2026-08-11 22:54:49Scott JF, Gerstenblith MR (eds.). Noncutaneous Melanoma. Brisbane (AU): Codon Publications. ISBN 978-0-9944381-5-7. PMID 29874016. Retrieved 2026-06-27...
Click to read more »Aspartic acid
Selasa, 2026-07-14 04:09:10humans, meaning the body can synthesize it as needed. It is encoded by the codons GAU and GAC. In proteins aspartate sidechains are often hydrogen bonded...
Click to read more »Lyssavirus
Sabtu, 2026-05-02 00:55:50S2CID 25912333. He W, Zhang H, Zhang Y, Wang R, Lu S, Ji Y, et al. (October 2017). "Codon usage bias in the N gene of rabies virus". Infection, Genetics and Evolution...
Click to read more »Deformed wing virus
Selasa, 2026-08-11 22:55:39found between codons 1460 and 1575. The 3C protease domains span codons 2183 to 2327. The usual eight RdRp domains are located between codons 2493 and 2828...
Click to read more »Reading frame
Kamis, 2026-03-12 20:08:23equate to amino acids or stop signals during translation, they are called codons. A single strand of a nucleic acid molecule has a phosphoryl end, called...
Click to read more »MSRB1
Minggu, 2026-07-12 02:52:13(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein...
Click to read more »Three prime untranslated region
Selasa, 2026-01-27 13:14:51messenger RNA (mRNA) that immediately follows the translation termination codon. The 3′ UTR often contains regulatory regions that post-transcriptionally...
Click to read more »Ribosome profiling
Jumat, 2025-10-17 20:36:01lactidomycin to prevent any further initiation. This allows the starting codon of the mRNAs throughout the cell lysate to be analyzed, which has been used...
Click to read more »Erdheim–Chester disease
Jumat, 2026-08-07 21:28:09approximately half these patients harbor point mutations of the BRAF gene at codon 600 substituting the amino acid glutamine for valine. A diagnosis from neurological...
Click to read more »Adam Eyre-Walker
Selasa, 2026-07-28 16:40:24His doctoral thesis, submitted in 1992, was titled Studies of Synonymous Codon Evolution in Mammals and supervised by William G. Hill. Eyre-Walker joined...
Click to read more »ADAR
Selasa, 2026-08-11 17:09:21translation but can also bind to uracil and adenosine, though it is not favored. Codon changes may arise from RNA editing leading to changes in the coding sequences...
Click to read more »Peptidein
Senin, 2026-05-18 13:21:14of Medicine, in 1997. Some sORF are so small, usually shorter than 100 codons, that they were believed to have no protein-coding genes to make functional...
Click to read more »Ribosomal pause
Selasa, 2026-08-11 19:15:31these pause sites were tested with specific codons. No link was found between the occupancy of specific codons and amount of their tRNAs. Thus, the early...
Click to read more »Mild androgen insensitivity syndrome
Senin, 2026-02-02 16:02:11glutamine codon "CAG" and is thus known as the polyglutamine tract. The second microsatellite contains 4 to 31 repetitions of the glycine codon "GGC" and...
Click to read more »Gau
Minggu, 2026-05-31 19:19:40Germany Gau (Final Fantasy VI), a character in Final Fantasy VI GAU, a codon for the amino acid aspartic acid Gouais blanc, a French wine grape Enfariné...
Click to read more »5-HT2C receptor
Kamis, 2026-08-06 09:12:47If an editing site occurs within a coding sequence, it can result in a codon change. This can lead to translation of a protein isoform due to a change...
Click to read more »FAM131A
Kamis, 2025-10-30 23:25:32start codon, exon boundaries, polyadenylation signals, polyadenylation sites, disordered region, region excluded from isoform 2, and stop codon. Amino...
Click to read more »TCC
Rabu, 2026-04-01 02:21:21classification, a climate classification system Triclocarban, a disinfectant TCC, a codon for the amino acid serine Take Command Console, a command line interpreter...
Click to read more »Scrapie
Minggu, 2026-08-16 13:26:21identified as highly polymorphic and may have an effect on scrapie: codons 136, 154, and 171. Codon 154 has not shown any evidence of having a high effect on scrapie...
Click to read more »Non-proteinogenic amino acids
Jumat, 2026-07-31 20:19:40acids do not have a dedicated codon, but are added in place of a stop codon when a specific sequence is present, UGA codon and SECIS element for selenocysteine...
Click to read more »GTA
Jumat, 2026-05-15 17:47:19bacteria Global Technology Associates, an Internet firewall maker GTA, a codon for the amino acid valine GTA Teleguam, a telecommunications company in...
Click to read more »CTT
Rabu, 2025-12-17 23:20:34Transport's ICAO code CTT, a specialty certification of Comp TIA CTT, a codon for the amino acid Leucine × Cattlianthe (Ctt.), a nothogenus of orchids...
Click to read more »Valine
Minggu, 2026-07-05 11:22:16dairy products, soy products, beans and legumes. It is encoded by all codons starting with GU (GUU, GUC, GUA, and GUG). Valine was first isolated from...
Click to read more »RNA editing
Rabu, 2026-08-19 13:29:10create start and stop codons, but it cannot destroy existing start and stop codons. A cryptic start codon is created when the codon ACG is edited to be...
Click to read more »Nested gene
Senin, 2023-02-06 21:51:16entire coding sequence lies within the bounds (between the start codon and the stop codon) of a larger external gene. The coding sequence for a nested gene...
Click to read more »List of awards and nominations received by Star Trek: Deep Space Nine
Rabu, 2025-03-05 14:08:54Lee, Ronald W. Smith, Gerald Solomon, Michael Moore, Chris McBee, Caryl Codon-Tharp, Faith Vecchio, Rebecca De Morrio, Joan Phillips Improbable Cause...
Click to read more »Mesodinium nuclear code
Senin, 2025-09-08 07:41:01Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in Condylostoma magnum". Molecular Biology and Evolution. 33 (11):...
Click to read more »Epithelial-myoepithelial carcinoma
Kamis, 2025-07-10 23:38:04survival. Gain-of-function missense mutations which primarily occurs at codons 12, 13, and 61, maintain RAS in an active state. These RAS proteins act...
Click to read more »Untranslated region
Minggu, 2026-01-04 09:53:07eukaryotes. The 3' UTR is found immediately following the translation stop codon. The 3' UTR plays a critical role in translation termination as well as...
Click to read more »Genetic assimilation
Sabtu, 2026-01-17 07:51:30the existence of genetic assimilation in evolution; in yeast, when a stop codon is lost by mutation, the reading frame is preserved much more often than...
Click to read more »AAG
Senin, 2026-07-27 20:07:01glycosylase; see Deamination Autoimmune autonomic ganglionopathy AAG, a codon for the amino acid lysine American Association of Geographers Association...
Click to read more »Coding region
Rabu, 2025-07-23 06:01:03similar to the low GC-content of the base composition translational stop codons like TAG, TAA, and TGA. GC-rich areas are also where the ratio point mutation...
Click to read more »Oxford–AstraZeneca COVID-19 vaccine
Selasa, 2026-08-11 18:57:57replication-deficient chimpanzee adenovirus ChAdOx1, containing the full‐length codon‐optimised coding sequence of SARS-CoV-2 spike protein along with a tissue...
Click to read more »KLHL36
Senin, 2026-05-11 10:51:02Conceptual Translation of KLHL36 Transcript Variant 1 mRNA, including BTB/POZ domain, BACK domain, Kelch Motifs, start and stop codons, and exon boundaries....
Click to read more »Glutamic acid
Kamis, 2026-08-06 09:45:54zwitterion structure −OOC−CH(NH+ 3)−(CH 2)2−COOH. It is encoded by the codons GAA or GAG. The acid can lose one proton from its second carboxyl group...
Click to read more »Philip Leder
Jumat, 2025-05-30 23:00:22Dana-Farber/Harvard Cancer Center Links to digital facsimiles Leder's 'Codon notebooks' documenting the Nirenberg and Leder experiment can be found in...
Click to read more »Ribosome-binding site
Sabtu, 2025-11-15 04:28:08binding site (RBS), is a sequence of nucleotides upstream of the start codon of an mRNA transcript that is responsible for the recruitment of a ribosome...
Click to read more »AGT
Minggu, 2026-06-07 15:15:57Seven Network reality TV show Agaritine, a hydrazine derivative AGT, a codon for the amino acid Serine Angiotensinogen, a protein Antiglobulin test,...
Click to read more »Cardigan Welsh Corgi
Selasa, 2026-08-11 22:43:04David D. (June 2002). "An improved DNA‐based test for detection of the codon 616 mutation in the alpha cyclic GMP phosphodiesterase gene that causes...
Click to read more »Isoleucine
Kamis, 2026-08-06 15:37:31a pyruvate employing leucine biosynthesis enzymes. It is encoded by the codons AUU, AUC, and AUA. In plants and microorganisms, isoleucine is synthesized...
Click to read more »Transmembrane protein 145
Senin, 2026-02-02 21:01:05TMEM145 conceptual translation. This includes the signal peptide, cleavage site, exon boundaries, transmembrane domains, and the start and stop codons....
Click to read more »MUSCLE (alignment software)
Selasa, 2026-08-11 18:36:47bioinformatics platforms. It is fully integrated into software programs such as CodonCode Aligner, DNASTAR's Lasergene, Geneious, and MacVector, and is also available...
Click to read more »Insertion (genetics)
Jumat, 2026-07-10 13:19:11nucleotides is not divisible by three, i.e., the number of nucleotides per codon. Frameshift mutations will alter all the amino acids encoded by the gene...
Click to read more »Cystic fibrosis transmembrane conductance regulator
Minggu, 2026-07-12 02:29:34spanning codons for amino acid positions 507 and 508 of the CFTR gene on chromosome 7, which ultimately results in the loss of a single codon for the amino...
Click to read more »Boehm garbage collector
Senin, 2026-03-23 17:47:00runtime environments for a number of other languages, including Crystal, the Codon high performance python compiler, the GNU Compiler for Java runtime environment...
Click to read more »Saint Louis encephalitis
Kamis, 2026-03-26 09:36:34American strains around 1892. Scans for natural selection showed that most codons of the SLE virus ORF were evolving neutrally or under negative selection...
Click to read more »Lysine
Minggu, 2026-08-16 11:46:46water at physiological pH), aliphatic amino acid. It is encoded by the codons AAA and AAG. Like almost all other amino acids, the α-carbon is chiral and...
Click to read more »Larry Simpson
Rabu, 2026-03-25 01:08:35and deletion generates conserved amino acid sequences and AUG initiation codons". Cell. 53 (3): 401–411. doi:10.1016/0092-8674(88)90160-2. ISSN 0092-8674...
Click to read more »Lethal allele
Kamis, 2026-08-20 05:33:15In addition, it was found that an amber mutation produces a "nonsense codon" within a gene that causes polypeptide chain termination during translation...
Click to read more »Filariasis
Sabtu, 2026-06-27 10:07:25an extra 29 amino acid long extension. The WbSXP-1 variant, where a stop codon has been introduced at the amino acid position 153 has been shown to be...
Click to read more »CAC
Sabtu, 2026-06-13 20:45:41Sistema Avariynogo Spaseniya, SAS), the Soyuz launch escape system CAC, a codon for the amino acid histidine CaC, an acronym for "configuration as code"...
Click to read more »Har Gobind Khorana
Jumat, 2026-07-31 07:17:00dipeptides and tripeptides thus revealing that UAG, UAA, and UGA are stop codons. Their Nobel lecture was delivered on 12 December 1968. Khorana was the...
Click to read more »Blue–white screen
Minggu, 2023-12-03 07:36:25This occurs when the insert is "in frame" with the LacZα gene and a STOP codon is absent in the insert. This can lead to the expression of a fusion protein...
Click to read more »Pseudoachondroplasia
Senin, 2025-12-29 08:14:27the mutation responsible for the most common allele is a deletion of one codon within a very short triplet repeat (GAC), in which the 469th amino acid...
Click to read more »UCG
Sabtu, 2025-11-15 12:20:44Универзитет Црнe Горe) Serine, a proteinogenic amino acid, specified by redundant codons in the genetic code that include UCG UCG or United Communications Group...
Click to read more »ORF3b
Selasa, 2026-08-11 18:54:05SARS-CoV, ORF3b is a gene of 155 codons. In SARS-CoV-2, the homologous region of the genome includes several stop codons in the same reading frame, resulting...
Click to read more »ORF3d
Selasa, 2026-08-11 18:54:08SARS-CoV (about 155 codons) and SARS-CoV-2 (only 22 codons). Exacerbating the confusion, both the 57-codon protein product and the 22-codon protein product...
Click to read more »Gene
Rabu, 2026-08-19 09:55:36Additionally, a "start codon", and three "stop codons" indicate the beginning and end of the protein coding region. There are 64 possible codons (four possible...
Click to read more »Lethal white syndrome
Selasa, 2026-07-21 20:46:11"frame" allele on endothelin receptor B (EDNRB); Ile to Lys substitution at codon 118. Risk factors If both parents are heterozygotes for frame, there is...
Click to read more »EF-Tu
Minggu, 2026-08-16 08:52:00information that encodes the primary structure of a protein, and contains codons that code for each amino acid. The ribosome creates the protein chain by...
Click to read more »Spot-tag
Selasa, 2026-08-11 19:28:24A Spot-tag is a 12-amino acid peptide tag recognized by a single-domain antibody (sdAb, or nanobody). Due to the small size of a Spot-tag (12 amino acids)...
Click to read more »Shope papilloma virus
Sabtu, 2026-04-18 14:31:00viral DNA. E1 is the largest open reading frame (ORF), which is the set of codons in the genome that code for proteins, encoding a 602 amino acid protein...
Click to read more »Black wolf
Senin, 2026-07-27 17:22:50allele in the Agouti gene in dogs (R96C arginine to cysteine mutation at codon 96). This recessive black gene is also thought to have derived from wild...
Click to read more »MTRR (gene)
Sabtu, 2026-07-11 18:00:52methionine at codon 22. This mutation is found within and affects the FMN binding domain. (MTRR):c.524C>T – Serine to leucine substitution at codon 175. Benign...
Click to read more »Ochre (disambiguation)
Rabu, 2025-01-01 22:46:34singer-songwriter Ochre River, Manitoba, in Canada Ochre, a type of genetics stop codon Ocher, alternative spelling of Ochyor, a town in Perm Krai, Russia Ogre...
Click to read more »AGG
Sabtu, 2026-08-08 01:58:49Geometry, computer graphics rendering library Arginine, an amino acid with codon AGG Species aggregate, abbreviated "agg." Tirofiban, trade name Aggrastat...
Click to read more »Leber's hereditary optic neuropathy
Sabtu, 2026-08-01 22:37:12families. This mutation converts a highly conserved arginine to histidine at codon 340 in the NADH dehydrogenase subunit 4 of complex I of the mitochondrial...
Click to read more »Pharmacogenomics
Minggu, 2026-08-09 03:52:26mutations that prematurely terminate the synthesized protein (early stop codon). The term pharmacogenomics is often used interchangeably with pharmacogenetics...
Click to read more »Act
Senin, 2026-08-10 02:45:06Assertive community treatment, a system for treating mental illness ACT, a codon for the amino acid Threonine ACT (audio format), a file format Act or S-act...
Click to read more »Aminoacyl tRNA synthetase
Sabtu, 2026-07-25 14:01:45by a nonsense (TAG, TGA, TAA) triplet, a quadruplet codon, or in some cases a redundant rare codon. The organism that expresses the mutant synthetase can...
Click to read more »Asgard archaea
Senin, 2026-08-17 11:33:12Tanja; Hugenholtz, Philip; Rinke, Christian (2021-12-01). "Recoding of stop codons expands the metabolic potential of two novel Asgardarchaeota lineages"....
Click to read more »Neural Darwinism
Kamis, 2026-05-28 07:50:19The ingenuous 1964 Nirenberg and Leder experiment would identify the mRNA codons, a triplet sequence of ribonucleotides, that coded for each amino acid;...
Click to read more »Neutral theory of molecular evolution
Rabu, 2026-07-29 10:24:55nucleotide substitution are particularly high in the third position of a codon, where there is little functional constraint. This view is based in part...
Click to read more »TMED5
Kamis, 2025-10-30 23:23:17Conceptual translation of TMED5. Labeled are the start and stop codon, exon splice sites, domains and motifs, polyadenylation signals, predicted RNA and...
Click to read more »Tobacco mosaic virus
Kamis, 2026-08-13 07:57:38produce a single protein due to ribosomal readthrough of a leaky UAG stop codon. The four genes encode a replicase (with methyltransferase [MT] and RNA...
Click to read more »Kisspeptin
Sabtu, 2026-07-25 21:40:40site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is used, and the encoded protein extends for...
Click to read more »Lactate dehydrogenase
Jumat, 2026-07-10 08:32:50mRNA, but the stop codon is interpreted as an amino acid-encoding codon. In consequence, translation continues to the next stop codon. This leads to the...
Click to read more »Fulgoridae
Senin, 2026-03-16 00:36:051962 (southern Africa) Capocles Emeljanov, 2004 Capenopsis Melichar, 1912 Codon Fennah, 1962 Strongylodemas Stål, 1853 Tecmar Fennah, 1962 Xosopharinae...
Click to read more »ATC
Minggu, 2026-07-19 08:35:00studies the effects of hazards on the built environment (founded 1973) ATC, a codon for the amino acid isoleucine Acute traumatic coagulopathy, in hematology...
Click to read more »C8orf58
Kamis, 2025-10-30 23:05:15Transcript Variant 1 1, 2, 3, 4, 5, 6, 7 2062 One upstream in-frame stop codon. Transcript Variant 2 1, 2, 3, 4, 5, 6, 7 2038 Alternate in-frame splice...
Click to read more »Library (biology)
Selasa, 2026-06-23 09:23:15libraries (formed by de novo gene synthesis where alternative nucleotides or codons are incorporated). DNA library technology is a mainstay of current molecular...
Click to read more »Cyanosis
Kamis, 2026-05-28 23:18:08Polycythemia Congenital cyanosis (HbM Boston) arises from a mutation in the α-codon which results in a change of primary sequence, H → Y. Tyrosine stabilizes...
Click to read more »SARS-CoV-2
Kamis, 2026-08-13 08:38:25virus to have a noticeable codon usage bias. For instance, arginine's six different codons have a relative synonymous codon usage of AGA (2.67), CGU (1...
Click to read more »The Standard Code
Senin, 2014-10-13 21:55:30to the standard genetic code, described at Genetic code#RNA codon table (see also DNA codon table) This disambiguation page lists articles associated with...
Click to read more »Pathogenicity island
Minggu, 2026-03-01 15:58:34which is usually shown by the presence of an integrase. The GC-content and codon usage of pathogenicity islands often differs from that of the rest of the...
Click to read more »FNDC5
Minggu, 2026-08-16 12:32:01mammals; the human and murine sequences are identical. However, the start codon of human FNDC5 is mutated to ATA.[citation needed] This causes human FNDC5...
Click to read more »Carney complex
Senin, 2026-05-18 12:24:15histidine: guanine (G)-> adenosine (A) transition in the second codon position of the 74th codon in the protein) mutation in the PRKAR1A gene, confirming a...
Click to read more »UUU
Kamis, 2025-10-23 20:01:31composition (uuu) -- triple up quarks UUU, or uracil uracil uracil, the RNA codon for phenylalanine Uranium One (TSX: UUU, JSE: UUU), Canadian-based uranium...
Click to read more »Steven A. Benner
Rabu, 2026-07-08 10:36:47possible codons, while an expanded DNA alphabet with 9 DNA bases would have 93 = 729 possible codons, many of them synthetic codons. For these codons to be...
Click to read more »5α-Reductase 2 deficiency
Selasa, 2026-08-04 13:47:522 protein, mutations in codons specifying 67 different residues have been identified, with multiple mutations in the codons of several amino acids. The...
Click to read more »GCN
Kamis, 2026-03-19 12:34:08Graphics Core Next, an AMD graphics microarchitecture series Degenerate codon for the amino acid Alanine (A) Grand Canyon National Park Airport (IATA...
Click to read more »Extrachromosomal DNA
Minggu, 2026-06-14 21:01:19fungi, animals, protists and plants. While most of the 3-base sequences (codons) in the mtDNA of these organisms do code for the same amino acids as those...
Click to read more »Gene knockout
Rabu, 2026-04-29 09:03:18that can precisely target a DNA sequence. Each zinc-finger can recognize codons of a desired DNA sequence, and therefore can be modularly assembled to bind...
Click to read more »Titin
Selasa, 2026-08-18 16:27:21within the unusually long sequence of this gene can cause premature stop codons or other defects. Titin mutations are associated with hereditary myopathy...
Click to read more »4-Aminobiphenyl
Senin, 2026-08-10 21:39:09common hotspots in several human cancers, which are on codons 175, 248 and 273. The other two codons are 280 and 285 do not have CpG sites. These sites are...
Click to read more »List of awards and nominations received by Star Trek: Voyager
Rabu, 2024-05-15 01:46:05Individual Achievement in Hairstyling for a Series Josée Normand, Caryl Codon, Rebecca De Morrio, Dino Ganziano, Virginia Kearns, Audrey Levy, Shawn McKay...
Click to read more »List of Ben 10: Ultimate Alien episodes
Minggu, 2026-08-09 03:24:07travels to the planet Aranhaschimmia to investigate a disturbance in the Codon Stream, discovering that the planet has become infested with DNAliens. On...
Click to read more »Nail clubbing
Selasa, 2026-07-14 15:37:23W, Spritz RA (August 2017). "Homozygous SLCO2A1 translation initiation codon mutation in a Pakistani family with recessive isolated congenital nail clubbing"...
Click to read more »Aflatoxin
Senin, 2026-08-10 21:13:05some base pair locations more than others; for example, the third base of codon 249 of the p53 gene appears to be more susceptible to aflatoxin-mediated...
Click to read more »Gentamicin
Kamis, 2026-07-09 20:53:02messenger RNA interactions. Typically, if an incorrect tRNA pairs with an mRNA codon at the aminoacyl site of the ribosome, adenosines 1492 and 1493 are excluded...
Click to read more »Gene product
Rabu, 2026-04-15 21:58:16corresponding sequence of three bases in DNA, called a codon. Soon after this, the specific codon assignments for each amino acid were determined. Fearon...
Click to read more »C5orf22
Kamis, 2025-10-30 23:21:26B-sheet:Beta-pleated sheet. NLS:Nuclear localization signal.Stop: Stop codon. miRNA site: miRNA site with target score of 98%, indicated by miRDB. PolyA...
Click to read more »Mupirocin
Sabtu, 2026-06-20 04:07:49"Synthesis of guanosine tetra- and pentaphosphate requires the presence of a codon-specific, uncharged transfer ribonucleic acid in the acceptor site of ribosomes"...
Click to read more »Aminoglycoside
Sabtu, 2026-08-08 20:58:10stop codons (leading to early termination of protein synthesis and truncated proteins). Aminoglycosides can cause the cell to overcome the stop codons, insert...
Click to read more »AAT
Rabu, 2026-07-29 02:43:56Aspartate transaminase, or aspartate aminotransferase, an enzyme AAT, a codon for the amino acid asparagine Achanalt railway station Asia Airfreight Terminal...
Click to read more »RNA world
Minggu, 2026-08-16 13:21:16PMC 9653231. PMID 36350219. Erives A (August 2011). "A model of proto-anti-codon RNA enzymes requiring L-amino acid homochirality". Journal of Molecular...
Click to read more »Non-canonical base pairing
Selasa, 2026-08-11 18:52:34particular, is abundant in tRNA anticodon loops and facilitates flexible codon recognition. Sheared G:A and reverse Hoogsteen A:U pairs commonly stabilize...
Click to read more »Splice site mutation
Senin, 2026-01-19 11:53:36brought on due to a splice site mutation. In addition to a mutation in a stop codon, a splice site mutation on the 3' strand was found in a gene coding for...
Click to read more »Autoimmune urticaria
Sabtu, 2026-08-15 00:18:48patients with chronic urticaria". Allergologia et Immunopathologia. 44 (4). Codon Publications: 286–291. doi:10.1016/j.aller.2015.10.004. ISSN 0301-0546....
Click to read more »Glycine
Kamis, 2026-08-06 15:35:47fundamental building block of proteins in all life and is encoded by all codons starting with GG (GGU, GGC, GGA, and GGG). Because of its minimal side chain...
Click to read more »Alagille syndrome
Senin, 2026-02-02 02:02:58mutation is a point mutation that changes one nucleotide, which results in a codon that codes for the wrong amino acid. Alagille syndrome is inherited in an...
Click to read more »Artificial saliva
Kamis, 2025-07-17 23:30:00synthesis methods to overcome these challenges. The methods were guided by codon scrambling algorithms to reduce repetition in DNA sequences while conserving...
Click to read more »Tetracycline-controlled transcriptional activation
Jumat, 2026-01-02 01:12:10is considered to be more stable in eukaryotic cells due to being human codon optimized and utilizing three minimal transcriptional activation domains...
Click to read more »CCDC60
Rabu, 2026-07-29 06:57:45Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving...
Click to read more »Orders of magnitude (data)
Senin, 2026-06-29 10:54:38Fieldata, in IBM "BCD" format, and in Braille. Enough to uniquely identify one codon of genetic code. The size of code points in Base64; thus, often the entropy...
Click to read more »Aminoacyl-tRNA
Senin, 2025-11-10 05:23:44amino acid matching the anticodon of the tRNA, and in turn matching the codon of the mRNA, is used during protein synthesis. In order to prevent translational...
Click to read more »Cai
Rabu, 2026-08-05 01:25:05mineral Carbonic anhydrase inhibitor, in pharmacology Codon Adaptation Index, a measure of codon bias in protein-coding DNA sequences Cold air intake,...
Click to read more »Moderna COVID-19 vaccine
Kamis, 2026-07-16 22:08:04the human alpha globin gene (HBA1), introduction of two additional stop codons, terminated by a 3' poly(A) tail. A putative sequence of the vaccine has...
Click to read more »ACU
Kamis, 2026-08-06 02:52:59Uruguay, a member of the Fédération Internationale de l'Automobile ACU, a codon for the amino acid threonine ACU (Utrecht), a music venue in Utrecht, the...
Click to read more »43S preinitiation complex
Minggu, 2026-01-18 02:04:04other RNA helicases such as Ded1/DDX3 and DHX29) to locate the start codon. Start codon recognition occurs through base-pairing between the Met-tRNAiMet and...
Click to read more »ABO blood group system
Kamis, 2026-03-26 08:29:41group A allele, a guanosine base is subsequently deleted. A premature stop codon results from this frame-shift mutation. This variant is found worldwide...
Click to read more »List of alignment visualization software
Selasa, 2026-04-14 13:46:06No No Console-based (no GUI), yet with colors. Coding DNA is coloured by codon. FASTA, PHYLIP, Nexus, Clustal, Stockholm Free, GPL 3 No Cross-platform...
Click to read more »SLC46A3
Minggu, 2026-08-16 13:24:39Change Function Description rs1456067444 554 1 [T/G] [M/R] missense start codon rs749501877 679 46 [A/G] [N/S] missense N-glycosylation site rs776889950...
Click to read more »CUC
Selasa, 2024-09-10 21:02:38airport code for Camilo Daza International Airport, Cúcuta, Colombia CUC, codon for the amino acid leucine This disambiguation page lists articles associated...
Click to read more »Impulsivity
Rabu, 2026-08-19 21:52:38Zhifeng; Wedenoja, Juho; et al. (2010). "A population-specific HTR2B stop codon predisposes to severe impulsivity". Nature. 468 (7327): 1061–6. Bibcode:2010Natur...
Click to read more »Primetime Emmy Award for Outstanding Hairstyling for a Single-Camera Series
Minggu, 2026-07-12 16:05:54Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...
Click to read more »MDP syndrome
Sabtu, 2026-03-07 16:53:14with this syndrome have an identical genetic change, an inframe single codon deletion in POLD1 resulting in a loss of serine at position 605. The POLD1...
Click to read more »Phase variation
Jumat, 2025-09-26 14:31:47of repeats in the open reading frame can affect the codon sequence by adding a premature stop codon or by changing the sequence of the protein. This often...
Click to read more »Poliovirus
Selasa, 2026-02-24 08:57:11the 3' end. Codon use is not random; codons ending in adenosine are favoured, and those ending in cytosine or guanine are avoided. Codon use differs between...
Click to read more »PiggyBac transposon system
Kamis, 2026-04-16 02:48:09genetic engineering purposes. A version called mPB was created by optimizing codon usage for mammalian (mouse) with a 20x increase in activity, and further...
Click to read more »Cell-free protein synthesis
Selasa, 2026-08-11 22:44:36has been used for over 60 years, and notably, the first elucidation of a codon was done by Marshall Nirenberg and Heinrich J. Matthaei in 1961 at the National...
Click to read more »Fibrodysplasia ossificans progressiva
Minggu, 2026-08-16 14:59:55receptor type-1, a BMP type-1 receptor. The mutation causes substitution of codon 206 from arginine to histidine in the ACVR1 protein. This substitution causes...
Click to read more »CpG site
Rabu, 2026-08-12 03:28:15are more evenly distributed. The 5 exons of the APRT gene are indicated (blue), and the start (ATG) and stop (TGA) codons are emphasized (bold blue)....
Click to read more »Agrippa (A Book of the Dead)
Selasa, 2026-07-21 11:06:49with the visual motifs in the book. The genetic code has a codon entropy of 5.97 bits/codon, much higher than any natural DNA sequence known. However,...
Click to read more »CAG promoter
Kamis, 2025-11-13 18:55:16synthetic element was used in the pCAGGS expression vector. The initiation codon located at the proximal region of the second exon was disrupted by digesting...
Click to read more »Pfizer–BioNTech COVID-19 vaccine
Selasa, 2026-07-07 06:47:13ability, increasing expression and stimulating neutralizing antibodies; a codon-optimized gene of the full-length spike protein of SARS-CoV-2 (bases 103–3879);...
Click to read more »Sphaeroma terebrans
Kamis, 2024-12-12 13:47:18known that S. terebrans has 13 protein-coding genes with 3 stop codons and 6 start codons. Gene flow levels are low and diversity levels are very high in...
Click to read more »Duon
Sabtu, 2019-12-28 15:40:11Duon may refer to the following things: A DNA codon also serving as part of a transcription factor binding site Moel y Cerrig Duon, a summit in north...
Click to read more »TRNAIle-lysidine synthase
Rabu, 2025-12-31 12:32:25"molecular mechanism of lysidine synthesis that determines tRNA identity and codon recognition". Molecular Cell. 19 (2): 235–46. doi:10.1016/j.molcel.2005...
Click to read more »Octopodidae
Selasa, 2026-05-19 07:15:10likelihood phylogenetic tree based on 13 protein-coding genes partitioned by codon, and nodes with less than 70% bootstrap support are collapsed, forming polytomies...
Click to read more »TGG
Selasa, 2025-01-21 09:30:15developed in the Chomskyan tradition Tryptophan, written as TGG in the DNA codon table This disambiguation page lists articles associated with the title...
Click to read more »Chronic wasting disease
Kamis, 2026-08-06 01:41:24associated with widespread neurodegeneration. The allele which encodes leucine, codon 132 in the family of Elks, is either homozygous LL, homozygous MM, or heterozygous...
Click to read more »AGC
Sabtu, 2026-08-08 01:58:24The Gulf Clan), a drug cartel and paramilitary group in Colombia AGC, a codon for the amino acid serine Agra Cantonment railway station in Uttar Pradesh...
Click to read more »Labyrinthulomycetes
Selasa, 2026-07-14 18:32:48the alternative genetic code of its mitochondria which use TTA as a stop codon instead of coding for Leucine. This code is represented by NCBI translation...
Click to read more »Fundic gland polyposis
Minggu, 2026-02-15 20:44:45attenuated familial adenomatous polyposis with a new germline APC mutation at codon 161: report of a case". Diseases of the Colon and Rectum. 45 (10): 1397–402...
Click to read more »Escherichia coli BL21(DE3)
Selasa, 2026-08-11 15:45:00used to drive the T7 RNA polymerase), ind1 (inducible), sam7 ("amber" stop codon used to inactivate phage S gene), nin5 ("N-independent" deletion). Can be...
Click to read more »Human bocavirus
Sabtu, 2026-05-09 03:41:01downstream ATG and co-terminates. VP2 is translated from a non-canonical start codon GUG. A viral noncoding RNA of 140 nucleotides, named as bocavirus-encoded...
Click to read more »Primetime Emmy Award for Outstanding Hairstyling
Minggu, 2026-07-12 16:05:46Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...
Click to read more »CRISPR gene editing
Minggu, 2026-08-16 08:40:20to a pre-mature stop codon mutation in a dystrophin sequence to activate A-to-I editing of the stop codon to a read through codon in a model xenopus cell...
Click to read more »Molecular evolution
Senin, 2026-06-29 11:36:17to reflect mutational tendencies. Mutational biases also contribute to codon usage bias. Although such hypotheses are often associated with neutrality...
Click to read more »APOBEC
Minggu, 2026-01-25 14:27:01resulting structure interacts with the codon CAA at codon 2153 and deaminates it into UAA, producing a stop codon that results in mRNA that is translated...
Click to read more »Monogenic obesity
Minggu, 2026-05-03 12:30:16the homozygosity for LEP variants results in a C to T substitution at codon 105, leading to an Arg to Trp amino acid change. In another case study,...
Click to read more »Bias in the introduction of variation
Kamis, 2026-08-20 22:33:26GC-rich codons (Gly, Ala, Arg, Pro), and likewise, adaptive walks under AT bias result in proteins with more of the amino acids with AT-rich codons (Phe...
Click to read more »ZNF548
Kamis, 2025-08-28 09:25:17amino acids encoded by each codon are shown. Annotations in the figure include: an upstream in-frame stop, start and stop codons, exon boundaries, amino acids...
Click to read more »Variant Creutzfeldt–Jakob disease
Rabu, 2026-08-05 21:11:58revealed a higher proportion of valine homozygous (VV) genotype on the codon 129 of the gene encoding the prion protein (PRNP) compared with the general...
Click to read more »Apolipoprotein B
Sabtu, 2026-08-15 21:39:29single mRNA transcript larger than 16 kb. ApoB48 is generated when a stop codon (UAA) at residue 2153 is created by RNA editing. There appears to be a trans-acting...
Click to read more »Rs4680
Selasa, 2026-01-27 06:56:49between G→A results in an amino acid change from valine to methionine at codon 158. The A or Met allele is associated with lower enzymatic activity (due...
Click to read more »Gua
Jumat, 2025-01-10 09:17:14Gua (disambiguation), the name of two different communes in France GUA, a codon for the amino acid valine Gua or Guanine, a nucleobase found in the nucleic...
Click to read more »J. Heinrich Matthaei
Minggu, 2026-07-26 17:04:47series of Us or, as we now know the genetic code is read in triplets, the codon for phenylalanine is UUU. This single experiment opened the way to the solution...
Click to read more »Early-onset Alzheimer's disease
Selasa, 2026-08-11 23:00:35cleavage, the London mutation, as well as other mutations in the APP at codon 717, shifts the ratio of toxic Aβ species to the more aggregate-prone 42...
Click to read more »Mannan-binding lectin
Jumat, 2025-08-08 09:49:40in exon 1 of the human MBL2 gene, at codon 52 (Arg to Cys, allele D), codon 54 (Gly to Asp, allele B) and codon 57 (Gly to Glu, allele C), also independently...
Click to read more »GGT
Senin, 2023-03-20 17:38:45amino acid Glutathione hydrolase, an enzyme that hydrolyzes glutathione A codon for the amino acid Glycine Germline gene therapy, to treat genetic diseases...
Click to read more »Human mitochondrial molecular clock
Kamis, 2026-02-26 01:11:02described by Soares et al. (2009) Regions(s) Subregions (or site within codon) SNP rate (per site * year) Control region HVR I 1.6 × 10−7 HVR II 2.3 ×...
Click to read more »Synthetic genomics
Senin, 2026-08-17 18:56:512019, a full E. coli genome modified to only use 61 out of 64 possible codons called Syn61 was synthesized. It was assembled by bacterial conjugation...
Click to read more »Transversion
Minggu, 2026-08-16 13:38:09pronounced effect than a transition because the second and third nucleotide codon position of the DNA, which to a large extent is responsible for the degeneracy...
Click to read more »Denaturation (biochemistry)
Minggu, 2026-07-19 21:33:05acids. A protein is created by ribosomes that "read" RNA that is encoded by codons in the gene and assemble the requisite amino acid combination from the genetic...
Click to read more »Phred quality score
Minggu, 2025-09-14 03:31:31display, end clipping, and consensus determination; other programs like CodonCode Aligner also implement quality-based consensus methods. Quality scores...
Click to read more »MRNA vaccine
Senin, 2026-08-17 07:29:36half-life and, in turn, protein production. Replacing rare codons with synonymous codons frequently used by the host cell also enhances protein production...
Click to read more »The Ancestor's Tale
Senin, 2026-07-13 22:28:35As seen in "The Gibbon's Tale", the genetic code is degenerate, as many codons code for the same amino acid. A synonymous substitution will be invisible...
Click to read more »PRND
Jumat, 2025-07-18 01:01:05PMID 12200435. Infante J, Llorca J, Rodero L, et al. (2003). "Polymorphism at codon 174 of the prion-like protein gene is not associated with sporadic Alzheimer's...
Click to read more »PYLIS downstream sequence
Minggu, 2025-06-15 22:51:24This structural motif was previously thought to cause the UAG (amber) stop codon to be translated to the amino acid pyrrolysine instead of ending the protein...
Click to read more »Proto-metabolism
Selasa, 2026-08-11 19:09:56"Computational Analysis of a Prebiotic Amino Acid Synthesis with Reference to Extant Codon–Amino Acid Relationships". Life. 11 (12): 1343. Bibcode:2021Life...11.1343Y...
Click to read more »Cre recombinase
Minggu, 2026-08-16 08:46:52with conversion to preferred mammalian codons, the removal of reported cryptic splice sites, an altered stop codon, and reduced CpG content to reduce the...
Click to read more »GNC hypothesis
Rabu, 2024-09-04 00:15:08as follows: First, there emerged GNC primeval genetic codes involving 4 codons (GGC, GCC, GAC and GUC), which code 4 GADV-amino acids (glycine, alanine...
Click to read more »Multiple endocrine neoplasia type 2
Sabtu, 2025-06-28 09:26:13Multiple endocrine neoplasia type 2 (MEN2; also known as Pheochromocytoma (codons 630 and 634) and amyloid producing medullary thyroid carcinoma, PTC syndrome...
Click to read more »TAA (disambiguation)
Rabu, 2026-06-24 02:28:25factor Tachyarrhythmia absoluta, a form of cardiac arrhythmia TAA, a stop codon in molecular biology Thoracic aortic aneurysm Tanganyika African Association...
Click to read more »Agmatidine
Sabtu, 2026-07-04 03:32:08the AUA codon in many archaea and is required for aminoacylation of tRNAIle2 with isoleucine. The genetic code describes how triplet codons on mRNA are...
Click to read more »Nullomers
Sabtu, 2025-10-11 01:33:51of non-uniformity in genomic sequences. When a codon is artificially substituted with a synonymous codon, it often results in a lethal change and cell...
Click to read more »Paromomycin
Rabu, 2026-06-24 04:24:47involved in detection of correct Watson-Crick pairing between the codon and anti codon. When correct interactions are achieved, the binding provides energy...
Click to read more »Drosophila melanogaster
Jumat, 2026-08-14 06:55:13synthase, which is encoded on chromosome 3L. The gene has a premature stop codon in sepia flies, so that the flies cannot produce the pyrimidodiazepine synthase...
Click to read more »Caveolin 2
Selasa, 2026-06-30 23:29:57isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by...
Click to read more »GCC
Minggu, 2026-03-15 19:41:09conjecture, a mathematical conjecture proved in 2014 by Thomas Royen GCC, a codon for the amino acid alanine Gibbon Conservation Center, in Santa Clarita...
Click to read more »DCP1A
Kamis, 2025-07-17 00:04:41factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. DCP1A...
Click to read more »Drew Endy
Jumat, 2026-08-07 22:13:16start the Biobricks Foundation. He was also a co-founder of the now-defunct Codon Devices, a biotechnology startup company that aimed to commercialize synthetic...
Click to read more »Tat
Kamis, 2025-10-30 00:11:16pathway Tyrosine aminotransferase, an enzyme encoded by the TAT gene TAT, a codon for the amino acid Tyrosine Talbot railway station, Australia Tattenham...
Click to read more »DNA annotation
Minggu, 2026-08-16 12:21:23performed several tasks related to annotation, such as base and codon counts. In fact, codon usage was the main strategy used by several early protein coding...
Click to read more »Sex-lethal
Minggu, 2026-07-05 16:10:33transcript includes a "male-specific exon" (exon 3) that contains an early stop codon, resulting in a truncated, non-functional protein. In females, Sxl protein...
Click to read more »Dibucaine number
Senin, 2026-06-01 10:28:48of serum cholinesterase. The mutation in nucleotide 209, which changes codon 70 from GAT to GGT, was found by sequencing a genomic clone and sequencing...
Click to read more »Nonsynonymous substitution
Rabu, 2026-07-08 01:27:02stop codon. Another type of mutation that deals with stop codons is known as a nonstop mutation or readthrough mutation, which occurs when a stop codon is...
Click to read more »Ben Tennyson
Selasa, 2026-08-18 17:13:58Ultimatrix, which is synced to the prototype Omnitrix's DNA source, the Codon Stream. Ben has wielded the Ultimatrix for over a year since defeating Vilgax...
Click to read more »16S ribosomal RNA
Selasa, 2026-08-11 22:16:22the anti-Shine-Dalgarno sequence, which binds upstream to the AUG start codon on the mRNA. The 3′-end of 16S RNA binds to the proteins S1 and S21 which...
Click to read more »Francis Crick
Jumat, 2026-08-21 08:34:10could be as many as n3 codons. Research is currently being done to see if codons can be expanded to more than 3 bases. These new codons can code for new amino...
Click to read more »Bacillus subtilis
Minggu, 2026-06-21 21:43:02tryptophan (Trp) for propagation were isolated. As Trp is only coded by a single codon, some evidence shows that Trp can be displaced by 4FTrp in the genetic code...
Click to read more »Selenoprotein
Kamis, 2026-04-02 12:47:22the ribosome's A site for the UGA codon to be decoded. In bacteria, the SECIS element occurs soon after the UGA codon it activates. The situation with...
Click to read more »TMEM212
Kamis, 2025-10-30 23:24:39exons, a coding sequence of 1881 nucleotides, and an upstream in-frame stop codon. The coding sequence is the 36-660 bases of the gene TMEM212. Other genes...
Click to read more »CGU
Jumat, 2026-05-01 03:06:36Office of the Inspector General (Brazil), abbreviated CGU in Portuguese a codon for the amino acid arginine a cash generating unit, an IFRS accounting term...
Click to read more »ATUM
Minggu, 2026-06-14 23:52:51applications in biotechnology, specifically in gene synthesis. It developed codon optimization strategies, designed to leverage the redundancy in the genetic...
Click to read more »William H. Andrews (biologist)
Selasa, 2026-08-18 03:29:18first worked at the biotechnology company Armos Corporation then Codon Corporation. Codon was purchased by Schering AG and became Berlex Biosciences. In...
Click to read more »Cafileria
Selasa, 2026-08-18 03:55:56eukaryotic groups, in which the UGA codon codes for the aminoacid tryptophan and the UAA/UAG codons are the stop codons. The mitochondrial genome is also...
Click to read more »Myhre syndrome
Selasa, 2026-06-23 04:50:26Arnold; Cormier-Daire, Valérie (December 2011). "Mutations at a single codon in Mad homology 2 domain of SMAD4 cause Myhre syndrome". Nature Genetics...
Click to read more »Capsomere
Minggu, 2024-04-21 08:25:00viral genome is being as economic as possible by only needing a few protein codons to make a large structure. One of the major functions of a capsid is to...
Click to read more »Attenuator (genetics)
Sabtu, 2026-02-14 12:30:45operon. First, Yanofsky observed that the ORF contained two tandem Trp codons and the protein had a Trp percent composition which was about 10X normal...
Click to read more »Brown greater galago prosimian foamy virus
Kamis, 2026-06-11 07:12:17along with accessory genes bel1 (tas) and bel2 (bet). No in-frame stop codons are present in the coding regions. Virions share the general spumaviral...
Click to read more »Verrucous carcinoma
Senin, 2025-12-08 02:18:11RG, Kerr IB, Mehta AR, et al. (April 1991). "High frequency mutation in codons 12 and 61 of H-ras oncogene in chewing tobacco-related human oral carcinoma...
Click to read more »FokI
Sabtu, 2026-04-11 02:36:44gene variants is caused by a single nucleotide polymorphism in the start codon of the gene which can be distinguished through the use of the Fok1 enzyme...
Click to read more »History and naming of human leukocyte antigens
Selasa, 2026-08-04 11:30:44'haplotype'. This haplotype, Super-B8, is A1-Cw7-B8-DR3-DQ2, about 2 million DNA codons (the nucleotide building blocks) long. This chunk has avoided recombination...
Click to read more »Laminin
Senin, 2026-08-10 13:39:56the minimal LamB1 IRES motif between -293 and -1 upstream of the start codon. RNA affinity purification demonstrated that the La protein interacts with...
Click to read more »Evolution
Minggu, 2026-07-26 23:28:10literature. For instance, mutation biases are frequently invoked in models of codon usage. Such models also include effects of selection, following the...
Click to read more »Caenorhabditis elegans
Rabu, 2026-08-12 17:09:39reduced evolution rates. Sperm genes have short coding sequences, high codon bias, and disproportionate representation among orphan genes. These characteristics...
Click to read more »SEPP1
Senin, 2026-05-25 20:29:48containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein...
Click to read more »Lactis-leu-phe leader RNA motif
Senin, 2023-12-04 00:57:17leaders. They contain a short open reading frame (ORF) that contains many codons for leucine or phenylalanine. Normally, expression of the downstream genes...
Click to read more »Dysmenorrhea
Minggu, 2026-08-16 08:51:56second associated SNP was located 308 base pairs upstream from the start codon of the TNF-α gene, in which guanine was substituted for adenine. A GG genotype...
Click to read more »RNA-binding protein 8A
Kamis, 2025-07-17 01:30:36now thought that the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene also uses multiple polyadenylation...
Click to read more »Genome
Senin, 2026-08-03 14:32:40traits such as karyotype (chromosome number), genome size, gene order, codon usage bias, and GC-content to determine what mechanisms could have produced...
Click to read more »Cassette mutagenesis
Senin, 2024-04-01 19:41:24amino acids by introducing different codons or omitting codons. By including the SD sequence and the first few codons of a gene, a scientist can easily and...
Click to read more »Sup45p
Senin, 2024-12-02 10:47:32yeast eukaryotic release factor 1 (eRF1). Its job is to recognize stop codons in RNA and bind to them. It binds to the Sup35p protein and then takes on...
Click to read more »GENCODE
Rabu, 2026-07-22 02:10:37{ENSEMBL,HAVANA} 3 feature-type {gene,transcript,exon,CDS,UTR,start_codon,stop_codon,Selenocysteine} 4 genomic start location integer-value (1-based) 5...
Click to read more »Androgen insensitivity syndrome
Jumat, 2026-04-03 20:46:15glutamine codon "CAG" and is thus known as the polyglutamine tract. The second microsatellite contains 4 to 31 repetitions of the glycine codon "GGC" and...
Click to read more »Anonychia
Minggu, 2025-06-08 14:50:18gene in congenital hyponychia and evidence for a polymorphic initiation codon (p.M1I). BMC Med Genet 13(1):120 Wiktionary has definitions related to Anonychia...
Click to read more »Apterocerina
Senin, 2026-07-20 19:23:54Ulidiidae (Diptera: Tephritoidea): morphology, DNA evolution, and Markov codon models". Zoological Studies. 53 (1): Figure 7 Wings of Ulidiidae species...
Click to read more »Golden Gate Cloning
Sabtu, 2026-04-18 02:50:10an eight-nucleotide scar sequence, which codes for a tyrosine and a stop codon, is left between every segment added into the plasmid. Golden Gate assembly...
Click to read more »AGU
Sabtu, 2026-08-08 03:07:22molecule in a polymer Aspartylglucosaminuria, a rare genetic illness a codon for the amino acid serine All Grown Up!, an animated television series Attorney...
Click to read more »Aphthovirus internal ribosome entry site (IRES)
Rabu, 2019-10-02 01:19:23recruiting a ribosomal 43S pre-initiation complex directly to the initiation codon and eliminates the requirement for the eukaryotic initiation factor eIF4F...
Click to read more »Rubella virus
Minggu, 2026-05-17 22:08:50known single stranded RNA virus (~70%). Despite this high GC content its codon use is similar to that of its human host. The viruses attach to the cell...
Click to read more »Epstein–Barr virus
Selasa, 2026-08-11 17:59:22initiation codon of the EBNA-LP coding region is created by an alternate splice of the nuclear protein transcript. In the absence of this initiation codon,...
Click to read more »RNA
Kamis, 2026-08-20 08:57:06synthesis factories in the cell. It is coded so that every three nucleotides (a codon) corresponds to one amino acid. In eukaryotic cells, once precursor mRNA...
Click to read more »MACC Fund
Selasa, 2026-06-23 09:43:04Survivors – What Do We Know Today?", Wilms Tumor, Codon Publications, pp. 131–145, doi:10.15586/codon.wt.2016.ch9, ISBN 978-0-9944381-1-9, PMID 27512760...
Click to read more »Eilat virus
Senin, 2025-03-10 07:51:36ORF's (Open Reading Frame which is an incessant stretch of codons that do not contain a stop codon). Four nonstructural proteins are encoded on two-thirds...
Click to read more »Telangiectasia macularis eruptiva perstans
Sabtu, 2025-11-22 10:56:22eruptiva perstans with montelukast". Allergologia et Immunopathologia. 37 (6). Codon Publications: 334–336. doi:10.1016/j.aller.2009.03.010. ISSN 0301-0546....
Click to read more »SnpEff
Sabtu, 2026-03-14 21:18:43functional class of the variant (nonsense, missense, frameshift etc.), codon change, amino acid change, amino acid length, gene name, gene biotype (protein...
Click to read more »SELENOS
Senin, 2026-04-27 01:21:51(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein...
Click to read more »Leukodystrophy
Rabu, 2026-07-29 02:32:25GALC gene that causes a frameshift mutation leading to a premature stop codon. The GALC gene, found on chromosome 14 at position 31 (14q31), codes for...
Click to read more »Vpu protein
Senin, 2024-04-15 11:26:18in the Vpu translation initiation codon but have otherwise intact vpu genes. Since removal of the Vpu initiation codon results in increased expression of...
Click to read more »Agriculture in California
Kamis, 2026-08-13 03:42:41commonly used in citrus here. Schmidt et al., 2006 find point mutations at codon 200 conferring TBZ resistance are common in California. Karnal Bunt (Tilletia...
Click to read more »Evolution of cetaceans
Minggu, 2026-08-16 08:56:19are primarily insertion/deletion mutations that result in premature stop codons. It is hypothesized that these mutations occurred in cetaceans already possessing...
Click to read more »Thermobiology
Senin, 2026-08-17 11:36:35subunit (30S), which then assembles other translation machinery. The start codon, typically found 8 nucleotides downstream of the Shine-Dalgarno sequence...
Click to read more »Methanosarcina mazei
Senin, 2026-06-29 13:11:25CRISPR, inducible promoters, and the use of pyrrolysyl-tRNA synthetases for codon expansion. Oshurkova, Viktoriia; Troshina, Olga; Trubitsyn, Vladimir; Ryzhmanova...
Click to read more »SOBP
Senin, 2026-02-09 12:06:32and leads to a frame-shift of the open reading frame introducing a stop codon at amino acid position 490 (S449fsX490). In the jc2J allele, the mutation...
Click to read more »Primer Premier
Minggu, 2025-04-06 19:24:52sequence translator which can be used for designing degenerate primers for codons that code for multiple amino acid sequences. It is also understood that...
Click to read more »Hok/sok system
Minggu, 2023-08-06 12:53:11long direct repeats (ldr) which encode short open reading frames of 35 codons organised in a homologous manner to the hok/sok system. One of the repeats...
Click to read more »Pseudogene
Minggu, 2026-08-16 09:36:48identification, the most commonly identified disablements are premature stop codons and frameshifts, which almost universally prevent the translation of a functional...
Click to read more »Aga
Kamis, 2025-10-16 10:35:11County, Romania, called Aga in Hungarian Monte Aga, mountain in Italy AGA, a codon for the amino acid arginine Aga (bird), Chamorro language name of Corvus...
Click to read more »Blastocrithidia
Kamis, 2025-09-18 21:20:31alternative genetic code characterized by all three canonical stop codons reassigned to sense codons. Laird, Marshall (1959-10-01). "Blastocrithidia n.g. (Mastigophora:...
Click to read more »Clustermarket
Kamis, 2026-06-25 19:01:572019, Start Codon, a UK based life sciences accelerator system announced its partnership with Calira. Calira would provide Start Codon's clients with...
Click to read more »Lily virus X
Senin, 2025-09-29 08:45:06encoding for RNA-dependent RNA polymerase (RdRp). The stop codon of the 24 kDa ORF and the start codon of the 12 kDa ORF overlap one another. While many potexvirus...
Click to read more »Microprotein
Minggu, 2026-08-16 09:44:24The active form is translated from smORF. smORFs can be less than 100 codons. However, not all microproteins are small, and the name was given because...
Click to read more »List of sequence alignment software
Jumat, 2026-07-24 19:23:49Schwartz et al. 2004, 2009 CodonCode Aligner Fast pairwise and multi-sequence alignments with multiple algorithms. Nucleotide Both CodonCode Corporation 2003-2025...
Click to read more »P120 catenin
Jumat, 2026-07-24 03:42:40between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated...
Click to read more »Adipose-secreted signaling protein
Minggu, 2026-08-16 08:31:34Conceptional translation of ADISSP. Labeled are start and stop codons, exon spliced regions, polyadrenylation signals, and ribosome binding site. Bold...
Click to read more »Carl Woese
Kamis, 2026-07-09 20:32:01base, rather than a triplet, to encode each amino acid, and suggested 18 codons, correctly predicting one for proline. Other work established the mechanistic...
Click to read more »CGC
Senin, 2026-03-16 04:15:08Challenge, a competition among completely-automatic hacking systems CGC, a codon for the amino acid arginine Chen Guangcheng, also known as the "Blind Lawyer"...
Click to read more »Myriapoda
Minggu, 2026-08-16 11:56:52Amino Acids in Deep-Level Arthropod Phylogenomics: Differentiating Serine Codons in 21-Amino-Acid Models". PLOS ONE. 7 (11) e47450. Bibcode:2012PLoSO...747450Z...
Click to read more »The Language of the Genes
Rabu, 2025-02-12 09:52:35the result of Jones' regular use of a metaphor of nucleotides as letters, codons as words and genes as sentences, but also reflecting Jones' short explanation...
Click to read more »Pseudouridine
Sabtu, 2026-04-04 02:55:11residues in mRNA can affect the coding specificity of stop codons UAA, UGA, and UAG. In these stop codons, both a U→Ψ modification and a U→C mutation promote...
Click to read more »